v2automation.ie Details

Select the tabs below for more information

Share This
Share On Facebook Share On Twitter Share On Google Share On LinkedIn Pinterest Email



v2automation.ie Domain Thumbnail

v2automation.ie

v2automation.ie

www.v2automation.ie

Social Media Link Popularity

Ads By Google

Server Information

SEO Title & Meta Tags

Title: V2 Automation – Auto Entry Systems

Summary

Skip to content (01) 626 4470 Parkwest Drive, O'Casey Ave, Park West Industrial Park, Dublin 12, D12 WC84 [email protected] V2 Automation Auto Entry Systems Home Products About Contact us Home Products About Contact us V2 ProductsTake a look at the products you are able to purchase from Auto Entry SystemsAlfariss24V irreversible electromechanical rack actuator motor reducer for sliding gates weighing up to 300 kg Manual Axil230V and 24V irreversible electromechanical actuator for swing gates with leaves up to 2.8 m in length Manual Ayros230V irreversible electromechanical rack actuator motor reducer for sliding gates weighing up to 1500 kg Manual Manual 24v Manual 1500l Bingo230V and

Domain and IP Whois Lookup Tool

Lookup Domain and IP Ownership Records:

Whois Information

DNS Information

Lookup DNS Records:

NS (Name Server) records are:

  • ns9.dnsireland.com
  • ns10.dnsireland.com

MX (Mail Exchanger) records are:

  • v2automation.ie

A records are:

  • host: v2automation.ie
  • class: IN
  • ttl: 14398
  • type: A
  • ip: 185.119.173.55
DNS Information

HTML Source

HTML Head Source:

			<html lang="en-US" class="no-js">
<!--<![endif]-->
<head>
	<meta charset="UTF-8" />
		<meta name="viewport" content="width=device-width, initial-scale=1, maximum-scale=1, user-scalable=0">
	    <meta name="theme-color" content="#e0001a"/>	<link rel="profile" href="http://gmpg.org/xfn/11" />
            <script type="text/javascript">
            if (/Android|webOS|iPhone|iPad|iPod|BlackBerry|IEMobile|Opera Mini/i.test(navigator.userAgent)) {
                var originalAddEventListener = EventTarget.prototype.addEventListener,
                    oldWidth = window.innerWidth;

                EventTarget.prototype.addEventListener = function (eventName, eventHandler, useCapture) {
                    if (eventName === "resize") {
                        originalAddEventListener.call(this, eventName, function (event) {
                            if (oldWidth === window.innerWidth) {
                                return;
                            }
                            else if (oldWidth !== window.innerWidth) {
                                oldWidth = window.innerWidth;
                            }
                            if (eventHandler.handleEvent) {
                                eventHandler.handleEvent.call(this, event);
                            }
                            else {
                                eventHandler.call(this, event);
                            };
                        }, useCapture);
                    }
                    else {
                        originalAddEventListener.call(this, eventName, eventHandler, useCapture);
                    };
                };
            };
        </script>
		<title>V2 Automation &#8211; Auto Entry Systems</title>
<link rel='dns-prefetch' href='//fonts.googleapis.com' />
<link rel='dns-prefetch' href='//s.w.org' />
<link rel="alternate" type="application/rss+xml" title="V2 Automation &raquo; Feed" href="https://v2automation.ie/feed/" />
<link rel="alternate" type="application/rss+xml" title="V2 Automation &raquo; Comments Feed" href="https://v2automation.ie/comments/feed/" />
<link rel="alternate" type="application/rss+xml" title="V2 Automation &raquo; V2 Automation Comments Feed" href="https://v2automation.ie/sample-page/feed/" />
		<script type="text/javascript">
			window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/11\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/11\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/v2automation.ie\/wp-includes\/js\/wp-emoji-release.min.js?ver=5.0.3"}};
			!function(a,b,c){function d(a,b){var c=String.fromCharCode;l.clearRect(0,0,k.width,k.height),l.fillText(c.apply(this,a),0,0);var d=k.toDataURL();l.clearRect(0,0,k.width,k.height),l.fillText(c.apply(this,b),0,0);var e=k.toDataURL();return d===e}function e(a){var b;if(!l||!l.fillText)return!1;switch(l.textBaseline="top",l.font="600 32px Arial",a){case"flag":return!(b=d([55356,56826,55356,56819],[55356,56826,8203,55356,56819]))&&(b=d([55356,57332,56128,56423,56128,56418,56128,56421,56128,56430,56128,56423,56128,56447],[55356,57332,8203,56128,56423,8203,56128,56418,8203,56128,56421,8203,56128,56430,8203,56128,56423,8203,56128,56447]),!b);case"emoji":return b=d([55358,56760,9792,65039],[55358,56760,8203,9792,65039]),!b}return!1}function f(a){var c=b.createElement("script");c.src=a,c.defer=c.type="text/javascript",b.getElementsByTagName("head")[0].appendChild(c)}var g,h,i,j,k=b.createElement("canvas"),l=k.getContext&&k.getContext("2d");for(j=Array("flag","emoji"),c.supports={everything:!0,everythingExceptFlag:!0},i=0;i<j.length;i++)c.supports[j[i]]=e(j[i]),c.supports.everything=c.supports.everything&&c.supports[j[i]],"flag"!==j[i]&&(c.supports.everythingExceptFlag=c.supports.everythingExceptFlag&&c.supports[j[i]]);c.supports.everythingExceptFlag=c.supports.everythingExceptFlag&&!c.supports.flag,c.DOMReady=!1,c.readyCallback=function(){c.DOMReady=!0},c.supports.everything||(h=function(){c.readyCallback()},b.addEventListener?(b.addEventListener("DOMContentLoaded",h,!1),a.addEventListener("load",h,!1)):(a.attachEvent("onload",h),b.attachEvent("onreadystatechange",function(){"complete"===b.readyState&&c.readyCallback()})),g=c.source||{},g.concatemoji?f(g.concatemoji):g.wpemoji&&g.twemoji&&(f(g.twemoji),f(g.wpemoji)))}(window,document,window._wpemojiSettings);
		</script>
		<style type="text/css">
img.wp-smiley,
img.emoji {
	display: inline !important;
	border: none !important;
	box-shadow: none !important;
	height: 1em !important;
	width: 1em !important;
	margin: 0 .07em !important;
	vertical-align: -0.1em !important;
	background: none !important;
	padding: 0 !important;
}
</style>
<link rel='stylesheet' id='wp-block-library-css'  href='https://v2automation.ie/wp-includes/css/dist/block-library/style.min.css?ver=5.0.3' type='text/css' media='all' />
<link rel='stylesheet' id='wp-block-library-theme-css'  href='https://v2automation.ie/wp-includes/css/dist/block-library/theme.min.css?ver=5.0.3' type='text/css' media='all' />
<link rel='stylesheet' id='contact-form-7-css'  href='https://v2automation.ie/wp-content/plugins/contact-form-7/includes/css/styles.css?ver=5.1.1' type='text/css' media='all' />
<link rel='stylesheet' id='rs-plugin-settings-css'  href='https://v2automation.ie/wp-content/plugins/revslider/public/assets/css/settings.css?ver=5.4.8.2' type='text/css' media='all' />
<style id='rs-plugin-settings-inline-css' type='text/css'>
#rs-demo-id {}
</style>
<link rel='stylesheet' id='the7-Defaults-css'  href='https://v2automation.ie/wp-content/uploads/smile_fonts/Defaults/Defaults.css?ver=5.0.3' type='text/css' media='all' />
<link rel='stylesheet' id='js_composer_front-css'  href='https://v2automation.ie/wp-content/plugins/js_composer/assets/css/js_composer.min.css?ver=5.5.2' type='text/css' media='all' />
<link rel='stylesheet' id='msl-main-css'  href='https://v2automation.ie/wp-content/plugins/master-slider/public/assets/css/masterslider.main.css?ver=3.5.3' type='text/css' media='all' />
<link rel='stylesheet' id='msl-custom-css'  href='https://v2automation.ie/wp-content/uploads/master-slider/custom.css?ver=1.2' type='text/css' media='all' />
<link rel='stylesheet' id='dt-web-fonts-css'  href='//fonts.googleapis.com/css?family=Roboto%3A400%2C600%2C700%7COpen+Sans%3A400%2C600%2C700%7CRoboto+Condensed%3A400%2C600%2C700&#038;ver=7.4.2' type='text/css' media='all' />
<link rel='stylesheet' id='dt-main-css'  href='https://v2automation.ie/wp-content/themes/dt-the7/css/main.min.css?ver=7.4.2' type='text/css' media='all' />
<style id='dt-main-inline-css' type='text/css'>
body #load {
  display: block;
  height: 100%;
  overflow: hidden;
  position: fixed;
  width: 100%;
  z-index: 9901;
  opacity: 1;
  visibility: visible;
  -webkit-transition: all .35s ease-out;
  transition: all .35s ease-out;
}
.load-wrap {
  width: 100%;
  height: 100%;
  background-position: center center;
  background-repeat: no-repeat;
  text-align: center;
}
.load-wrap > svg {
  position: absolute;
  top: 50%;
  left: 50%;
  -ms-transform: translate(-50%,-50%);
  -webkit-transform: translate(-50%,-50%);
  transform: translate(-50%,-50%);
}
#load {
  background-color: #ffffff;
}
.uil-default rect:not(.bk) {
  fill: rgba(51,51,51,0.3);
}
.uil-ring > path {
  fill: rgba(51,51,51,0.3);
}
.ring-loader .circle {
  fill: rgba(51,51,51,0.3);
}
.ring-loader .moving-circle {
  fill: #333333;
}
.uil-hourglass .glass {
  stroke: #333333;
}
.uil-hourglass .sand {
  fill: rgba(51,51,51,0.3);
}
.spinner-loader .load-wrap {
  background-image: url("data:image/svg+xml,%3Csvg width='75px' height='75px' xmlns='http://www.w3.org/2000/svg' viewBox='0 0 100 100' preserveAspectRatio='xMidYMid' class='uil-default'%3E%3Crect x='0' y='0' width='100' height='100' fill='none' class='bk'%3E%3C/rect%3E%3Crect  x='46.5' y='40' width='7' height='20' rx='5' ry='5' fill='rgba%2851%2C51%2C51%2C0.3%29' transform='rotate(0 50 50) translate(0 -30)'%3E  %3Canimate attributeName='opacity' from='1' to='0' dur='1s' begin='0s' repeatCount='indefinite'/%3E%3C/rect%3E%3Crect  x='46.5' y='40' width='7' height='20' rx='5' ry='5' fill='rgba%2851%2C51%2C51%2C0.3%29' transform='rotate(30 50 50) translate(0 -30)'%3E  %3Canimate attributeName='opacity' from='1' to='0' dur='1s' begin='0.08333333333333333s' repeatCount='indefinite'/%3E%3C/rect%3E%3Crect  x='46.5' y='40' width='7' height='20' rx='5' ry='5' fill='rgba%2851%2C51%2C51%2C0.3%29' transform='rotate(60 50 50) translate(0 -30)'%3E  %3Canimate attributeName='opacity' from='1' to='0' dur='1s' begin='0.16666666666666666s' repeatCount='indefinite'/%3E%3C/rect%3E%3Crect  x='46.5' y='40' width='7' height='20' rx='5' ry='5' fill='rgba%2851%2C51%2C51%2C0.3%29' transform='rotate(90 50 50) translate(0 -30)'%3E  %3Canimate attributeName='opacity' from='1' to='0' dur='1s' begin='0.25s' repeatCount='indefinite'/%3E%3C/rect%3E%3Crect  x='46.5' y='40' width='7' height='20' rx='5' ry='5' fill='rgba%2851%2C51%2C51%2C0.3%29' transform='rotate(120 50 50) translate(0 -30)'%3E  %3Canimate attributeName='opacity' from='1' to='0' dur='1s' begin='0.3333333333333333s' repeatCount='indefinite'/%3E%3C/rect%3E%3Crect  x='46.5' y='40' width='7' height='20' rx='5' ry='5' fill='rgba%2851%2C51%2C51%2C0.3%29' transform='rotate(150 50 50) translate(0 -30)'%3E  %3Canimate attributeName='opacity' from='1' to='0' dur='1s' begin='0.4166666666666667s' repeatCount='indefinite'/%3E%3C/rect%3E%3Crect  x='46.5' y='40' width='7' height='20' rx='5' ry='5' fill='rgba%2851%2C51%2C51%2C0.3%29' transform='rotate(180 50 50) translate(0 -30)'%3E  %3Canimate attributeName='opacity' from='1' to='0' dur='1s' begin='0.5s' repeatCount='indefinite'/%3E%3C/rect%3E%3Crect  x='46.5' y='40' width='7' height='20' rx='5' ry='5' fill='rgba%2851%2C51%2C51%2C0.3%29' transform='rotate(210 50 50) translate(0 -30)'%3E  %3Canimate attributeName='opacity' from='1' to='0' dur='1s' begin='0.5833333333333334s' repeatCount='indefinite'/%3E%3C/rect%3E%3Crect  x='46.5' y='40' width='7' height='20' rx='5' ry='5' fill='rgba%2851%2C51%2C51%2C0.3%29' transform='rotate(240 50 50) translate(0 -30)'%3E  %3Canimate attributeName='opacity' from='1' to='0' dur='1s' begin='0.6666666666666666s' repeatCount='indefinite'/%3E%3C/rect%3E%3Crect  x='46.5' y='40' width='7' height='20' rx='5' ry='5' fill='rgba%2851%2C51%2C51%2C0.3%29' transform='rotate(270 50 50) translate(0 -30)'%3E  %3Canimate attributeName='opacity' from='1' to='0' dur='1s' begin='0.75s' repeatCount='indefinite'/%3E%3C/rect%3E%3Crect  x='46.5' y='40' width='7' height='20' rx='5' ry='5' fill='rgba%2851%2C51%2C51%2C0.3%29' transform='rotate(300 50 50) translate(0 -30)'%3E  %3Canimate attributeName='opacity' from='1' to='0' dur='1s' begin='0.8333333333333334s' repeatCount='indefinite'/%3E%3C/rect%3E%3Crect  x='46.5' y='40' width='7' height='20' rx='5' ry='5' fill='rgba%2851%2C51%2C51%2C0.3%29' transform='rotate(330 50 50) translate(0 -30)'%3E  %3Canimate attributeName='opacity' from='1' to='0' dur='1s' begin='0.9166666666666666s' repeatCount='indefinite'/%3E%3C/rect%3E%3C/svg%3E");
}
.ring-loader .load-wrap {
  background-image: url("data:image/svg+xml,%3Csvg xmlns='http://www.w3.org/2000/svg' viewBox='0 0 32 32' width='72' height='72' fill='rgba%2851%2C51%2C51%2C0.3%29'%3E   %3Cpath opacity='.25' d='M16 0 A16 16 0 0 0 16 32 A16 16 0 0 0 16 0 M16 4 A12 12 0 0 1 16 28 A12 12 0 0 1 16 4'/%3E   %3Cpath d='M16 0 A16 16 0 0 1 32 16 L28 16 A12 12 0 0 0 16 4z'%3E     %3CanimateTransform attributeName='transform' type='rotate' from='0 16 16' to='360 16 16' dur='0.8s' repeatCount='indefinite' /%3E   %3C/path%3E %3C/svg%3E");
}
.hourglass-loader .load-wrap {
  background-image: url("data:image/svg+xml,%3Csvg xmlns='http://www.w3.org/2000/svg' viewBox='0 0 32 32' width='72' height='72' fill='rgba%2851%2C51%2C51%2C0.3%29'%3E   %3Cpath transform='translate(2)' d='M0 12 V20 H4 V12z'%3E      %3Canimate attributeName='d' values='M0 12 V20 H4 V12z; M0 4 V28 H4 V4z; M0 12 V20 H4 V12z; M0 12 V20 H4 V12z' dur='1.2s' repeatCount='indefinite' begin='0' keytimes='0;.2;.5;1' keySplines='0.2 0.2 0.4 0.8;0.2 0.6 0.4 0.8;0.2 0.8 0.4 0.8' calcMode='spline'  /%3E   %3C/path%3E   %3Cpath transform='translate(8)' d='M0 12 V20 H4 V12z'%3E     %3Canimate attributeName='d' values='M0 12 V20 H4 V12z; M0 4 V28 H4 V4z; M0 12 V20 H4 V12z; M0 12 V20 H4 V12z' dur='1.2s' repeatCount='indefinite' begin='0.2' keytimes='0;.2;.5;1' keySplines='0.2 0.2 0.4 0.8;0.2 0.6 0.4 0.8;0.2 0.8 0.4 0.8' calcMode='spline'  /%3E   %3C/path%3E   %3Cpath transform='translate(14)' d='M0 12 V20 H4 V12z'%3E     %3Canimate attributeName='d' values='M0 12 V20 H4 V12z; M0 4 V28 H4 V4z; M0 12 V20 H4 V12z; M0 12 V20 H4 V12z' dur='1.2s' repeatCount='indefinite' begin='0.4' keytimes='0;.2;.5;1' keySplines='0.2 0.2 0.4 0.8;0.2 0.6 0.4 0.8;0.2 0.8 0.4 0.8' calcMode='spline' /%3E   %3C/path%3E   %3Cpath transform='translate(20)' d='M0 12 V20 H4 V12z'%3E     %3Canimate attributeName='d' values='M0 12 V20 H4 V12z; M0 4 V28 H4 V4z; M0 12 V20 H4 V12z; M0 12 V20 H4 V12z' dur='1.2s' repeatCount='indefinite' begin='0.6' keytimes='0;.2;.5;1' keySplines='0.2 0.2 0.4 0.8;0.2 0.6 0.4 0.8;0.2 0.8 0.4 0.8' calcMode='spline' /%3E   %3C/path%3E   %3Cpath transform='translate(26)' d='M0 12 V20 H4 V12z'%3E     %3Canimate attributeName='d' values='M0 12 V20 H4 V12z; M0 4 V28 H4 V4z; M0 12 V20 H4 V12z; M0 12 V20 H4 V12z' dur='1.2s' repeatCount='indefinite' begin='0.8' keytimes='0;.2;.5;1' keySplines='0.2 0.2 0.4 0.8;0.2 0.6 0.4 0.8;0.2 0.8 0.4 0.8' calcMode='spline' /%3E   %3C/path%3E %3C/svg%3E");
}

</style>
<link rel='stylesheet' id='dt-awsome-fonts-back-css'  href='https://v2automation.ie/wp-content/themes/dt-the7/fonts/FontAwesome/back-compat.min.css?ver=7.4.2' type='text/css' media='all' />
<link rel='stylesheet' id='dt-awsome-fonts-css'  href='https://v2automation.ie/wp-content/themes/dt-the7/fonts/FontAwesome/css/all.min.css?ver=7.4.2' type='text/css' media='all' />
<link rel='stylesheet' id='dt-fontello-css'  href='https://v2automation.ie/wp-content/themes/dt-the7/fonts/fontello/css/fontello.min.css?ver=7.4.2' type='text/css' media='all' />
<link rel='stylesheet' id='the7pt-static-css'  href='https://v2automation.ie/wp-content/plugins/dt-the7-core/assets/css/post-type.min.css?ver=7.4.2' type='text/css' media='all' />
<link rel='stylesheet' id='dt-custom-css'  href='https://v2automation.ie/wp-content/uploads/the7-css/custom.css?ver=a3a7380bffc4' type='text/css' media='all' />
<link rel='stylesheet' id='dt-media-css'  href='https://v2automation.ie/wp-content/uploads/the7-css/media.css?ver=a3a7380bffc4' type='text/css' media='all' />
<link rel='stylesheet' id='the7pt.less-css'  href='https://v2automation.ie/wp-content/uploads/the7-css/post-type-dynamic.css?ver=a3a7380bffc4' type='text/css' media='all' />
<link rel='stylesheet' id='style-css'  href='https://v2automation.ie/wp-content/themes/dt-the7/style.css?ver=7.4.2' type='text/css' media='all' />
<link rel='stylesheet' id='ultimate-google-fonts-css'  href='https://fonts.googleapis.com/css?family=Open+Sans:regular,800,600' type='text/css' media='all' />
<link rel='stylesheet' id='ultimate-style-css'  href='https://v2automation.ie/wp-content/plugins/Ultimate_VC_Addons/assets/min-css/style.min.css?ver=3.17.1' type='text/css' media='all' />
<link rel='stylesheet' id='ultimate-headings-style-css'  href='https://v2automation.ie/wp-content/plugins/Ultimate_VC_Addons/assets/min-css/headings.min.css?ver=3.17.1' type='text/css' media='all' />
<link rel='stylesheet' id='style_ultimate_expsection-css'  href='https://v2automation.ie/wp-content/plugins/Ultimate_VC_Addons/assets/min-css/expandable-section.min.css?ver=3.17.1' type='text/css' media='all' />
<script type='text/javascript'>
/* <![CDATA[ */
var slide_in = {"demo_dir":"https:\/\/v2automation.ie\/wp-content\/plugins\/convertplug\/modules\/slide_in\/assets\/demos"};
/* ]]> */
</script>
<script type='text/javascript' src='https://v2automation.ie/wp-includes/js/jquery/jquery.js?ver=1.12.4'></script>
<script type='text/javascript' src='https://v2automation.ie/wp-includes/js/jquery/jquery-migrate.min.js?ver=1.4.1'></script>
<script type='text/javascript' src='https://v2automation.ie/wp-content/plugins/revslider/public/assets/js/jquery.themepunch.tools.min.js?ver=5.4.8.2'></script>
<script type='text/javascript' src='https://v2automation.ie/wp-content/plugins/revslider/public/assets/js/jquery.themepunch.revolution.min.js?ver=5.4.8.2'></script>
<script type='text/javascript'>
/* <![CDATA[ */
var dtLocal = {"themeUrl":"https:\/\/v2automation.ie\/wp-content\/themes\/dt-the7","passText":"To view this protected post, enter the password below:","moreButtonText":{"loading":"Loading...","loadMore":"Load more"},"postID":"2","ajaxurl":"https:\/\/v2automation.ie\/wp-admin\/admin-ajax.php","contactMessages":{"required":"One or more fields have an error. Please check and try again.","terms":"Please accept the privacy policy."},"ajaxNonce":"527e25fe72","pageData":{"type":"page","template":"page","layout":null},"themeSettings":{"smoothScroll":"off","lazyLoading":false,"accentColor":{"mode":"solid","color":"#e0001a"},"desktopHeader":{"height":100},"floatingHeader":{"showAfter":150,"showMenu":false,"height":60,"logo":{"showLogo":true,"html":"","url":"https:\/\/v2automation.ie\/"}},"mobileHeader":{"firstSwitchPoint":1070,"secondSwitchPoint":990,"firstSwitchPointHeight":60,"secondSwitchPointHeight":60},"stickyMobileHeaderFirstSwitch":{"logo":{"html":""}},"stickyMobileHeaderSecondSwitch":{"logo":{"html":""}},"content":{"textColor":"#85868c","headerColor":"#333333"},"boxedWidth":"1340px","stripes":{"stripe1":{"textColor":"#787d85","headerColor":"#3b3f4a"},"stripe2":{"textColor":"#8b9199","headerColor":"#ffffff"},"stripe3":{"textColor":"#ffffff","headerColor":"#ffffff"}}},"VCMobileScreenWidth":"768"};
var dtShare = {"shareButtonText":{"facebook":"Share on Facebook","twitter":"Tweet","pinterest":"Pin it","linkedin":"Share on Linkedin","whatsapp":"Share on Whatsapp","google":"Share on Google Plus","download":"Download image"},"overlayOpacity":"85"};
/* ]]> */
</script>
<script type='text/javascript' src='https://v2automation.ie/wp-content/themes/dt-the7/js/above-the-fold.min.js?ver=7.4.2'></script>
<script type='text/javascript' src='https://v2automation.ie/wp-content/plugins/Ultimate_VC_Addons/assets/min-js/ultimate-params.min.js?ver=3.17.1'></script>
<script type='text/javascript' src='https://v2automation.ie/wp-content/plugins/Ultimate_VC_Addons/assets/min-js/custom.min.js?ver=3.17.1'></script>
<script type='text/javascript' src='https://v2automation.ie/wp-content/plugins/Ultimate_VC_Addons/assets/min-js/headings.min.js?ver=3.17.1'></script>
<script type='text/javascript' src='https://v2automation.ie/wp-content/plugins/Ultimate_VC_Addons/assets/min-js/jquery-ui.min.js?ver=3.17.1'></script>
<script type='text/javascript' src='https://v2automation.ie/wp-content/plugins/Ultimate_VC_Addons/assets/min-js/expandable-section.min.js?ver=3.17.1'></script>
<link rel='https://api.w.org/' href='https://v2automation.ie/wp-json/' />
<link rel="EditURI" type="application/rsd+xml" title="RSD" href="https://v2automation.ie/xmlrpc.php?rsd" />
<link rel="wlwmanifest" type="application/wlwmanifest+xml" href="https://v2automation.ie/wp-includes/wlwmanifest.xml" /> 
<meta name="generator" content="WordPress 5.0.3" />
<link rel="canonical" href="https://v2automation.ie/" />
<link rel='shortlink' href='https://v2automation.ie/' />
<link rel="alternate" type="application/json+oembed" href="https://v2automation.ie/wp-json/oembed/1.0/embed?url=https%3A%2F%2Fv2automation.ie%2F" />
<link rel="alternate" type="text/xml+oembed" href="https://v2automation.ie/wp-json/oembed/1.0/embed?url=https%3A%2F%2Fv2automation.ie%2F&#038;format=xml" />
<script>var ms_grabbing_curosr = 'https://v2automation.ie/wp-content/plugins/master-slider/public/assets/css/common/grabbing.cur', ms_grab_curosr = 'https://v2automation.ie/wp-content/plugins/master-slider/public/assets/css/common/grab.cur';</script>
<meta name="generator" content="MasterSlider 3.5.3 - Responsive Touch Image Slider | avt.li/msf" />
<meta property="og:site_name" content="V2 Automation" />
<meta property="og:title" content="V2 Automation" />
<meta property="og:url" content="https://v2automation.ie/" />
<meta property="og:type" content="website" />
<link rel="pingback" href="https://v2automation.ie/xmlrpc.php">
		<style type="text/css">.recentcomments a{display:inline !important;padding:0 !important;margin:0 !important;}</style>
		<meta name="generator" content="Powered by WPBakery Page Builder - drag and drop page builder for WordPress."/>
<!--[if lte IE 9]><link rel="stylesheet" type="text/css" href="https://v2automation.ie/wp-content/plugins/js_composer/assets/css/vc_lte_ie9.min.css" media="screen"><![endif]--><meta name="generator" content="Powered by Slider Revolution 5.4.8.2 - responsive, Mobile-Friendly Slider Plugin for WordPress with comfortable drag and drop interface." />
<script type="text/javascript">
document.addEventListener("DOMContentLoaded", function(event) { 
	var load = document.getElementById("load");
	
	var removeLoading = setTimeout(function() {
		load.className += " loader-removed";
	}, 500);
});
</script>
<link rel="icon" href="https://v2automation.ie/wp-content/uploads/2018/07/images.jpg" type="image/jpeg" sizes="16x16"/><link rel="icon" href="https://v2automation.ie/wp-content/uploads/2018/07/images.jpg" type="image/jpeg" sizes="32x32"/><script type="text/javascript">function setREVStartSize(e){									
						try{ e.c=jQuery(e.c);var i=jQuery(window).width(),t=9999,r=0,n=0,l=0,f=0,s=0,h=0;
							if(e.responsiveLevels&&(jQuery.each(e.responsiveLevels,function(e,f){f>i&&(t=r=f,l=e),i>f&&f>r&&(r=f,n=e)}),t>r&&(l=n)),f=e.gridheight[l]||e.gridheight[0]||e.gridheight,s=e.gridwidth[l]||e.gridwidth[0]||e.gridwidth,h=i/s,h=h>1?1:h,f=Math.round(h*f),"fullscreen"==e.sliderLayout){var u=(e.c.width(),jQuery(window).height());if(void 0!=e.fullScreenOffsetContainer){var c=e.fullScreenOffsetContainer.split(",");if (c) jQuery.each(c,function(e,i){u=jQuery(i).length>0?u-jQuery(i).outerHeight(!0):u}),e.fullScreenOffset.split("%").length>1&&void 0!=e.fullScreenOffset&&e.fullScreenOffset.length>0?u-=jQuery(window).height()*parseInt(e.fullScreenOffset,0)/100:void 0!=e.fullScreenOffset&&e.fullScreenOffset.length>0&&(u-=parseInt(e.fullScreenOffset,0))}f=u}else void 0!=e.minHeight&&f<e.minHeight&&(f=e.minHeight);e.c.closest(".rev_slider_wrapper").css({height:f})					
						}catch(d){console.log("Failure at Presize of Slider:"+d)}						
					};</script>
<style type="text/css" data-type="vc_shortcodes-custom-css">.vc_custom_1517072009069{background-color: rgba(221,51,51,0.06) !important;*background-color: rgb(221,51,51) !important;}.vc_custom_1517072022060{background-color: rgba(221,51,51,0.06) !important;*background-color: rgb(221,51,51) !important;}.vc_custom_1532135010546{background-color: rgba(221,51,51,0.06) !important;*background-color: rgb(221,51,51) !important;}.vc_custom_1532135019816{background-color: rgba(221,51,51,0.06) !important;*background-color: rgb(221,51,51) !important;}.vc_custom_1532135033274{background-color: rgba(221,51,51,0.06) !important;*background-color: rgb(221,51,51) !important;}.vc_custom_1532135112864{background-color: rgba(221,51,51,0.06) !important;*background-color: rgb(221,51,51) !important;}.vc_custom_1532135064953{background-color: rgba(221,51,51,0.06) !important;*background-color: rgb(221,51,51) !important;}</style><noscript><style type="text/css"> .wpb_animate_when_almost_visible { opacity: 1; }</style></noscript>

			

HTML Body Source:

			<body class="home page-template-default page page-id-2 wp-embed-responsive the7-core-ver-1.17.1 _masterslider _ms_version_3.5.3 transparent light-preset-color slideshow-on dt-responsive-on srcset-enabled btn-flat custom-btn-color custom-btn-hover-color sticky-mobile-header top-header first-switch-logo-left first-switch-menu-right second-switch-logo-left second-switch-menu-right right-mobile-menu layzr-loading-on popup-message-style dt-fa-compatibility the7-ver-7.4.2 wpb-js-composer js-comp-ver-5.5.2 vc_responsive">
<!-- The7 7.4.2 -->
<div id="load" class="spinner-loader">
	<div class="load-wrap"></div>
</div>
<div id="page">
	<a class="skip-link screen-reader-text" href="#content">Skip to content</a>

<div class="masthead inline-header left widgets full-height shadow-decoration small-mobile-menu-icon dt-parent-menu-clickable show-device-logo show-mobile-logo" style="background-color: rgba(0,0,0,0.5);" role="banner">

			<div class="top-bar top-bar-line-hide">
			<div class="top-bar-bg"  style="background-color: rgba(255,255,255,0.25);"></div>
			<div class="left-widgets mini-widgets"><span class="mini-contacts phone show-on-desktop in-menu-first-switch near-logo-second-switch"><i class=" the7-mw-icon-phone-bold"></i>(01) 626 4470</span><span class="mini-contacts address show-on-desktop in-top-bar-left in-menu-second-switch"><i class=" the7-mw-icon-address-bold"></i>Parkwest Drive, O'Casey Ave, Park West Industrial Park, Dublin 12, D12 WC84</span></div>			<div class="right-widgets mini-widgets"><span class="mini-contacts email show-on-desktop in-menu-first-switch in-menu-second-switch"><i class=" the7-mw-icon-mail-bold"></i>[email protected]</span></div>		</div>

	<header class="header-bar">

						<div class="branding">
					<div id="site-title" class="assistive-text">V2 Automation</div>
					<div id="site-description" class="assistive-text">Auto Entry Systems</div>
									</div>
		<ul id="primary-menu" class="main-nav underline-decoration upwards-line outside-item-remove-margin" role="menu"><li class="menu-item menu-item-type-post_type menu-item-object-page menu-item-home current-menu-item page_item page-item-2 current_page_item menu-item-37 act first"><a href='https://v2automation.ie/' data-level='1'><span class="menu-item-text"><span class="menu-text">Home</span></span></a></li> <li class="menu-item menu-item-type-custom menu-item-object-custom menu-item-38"><a href='http://www.v2automation.ie/#products' data-level='1'><span class="menu-item-text"><span class="menu-text">Products</span></span></a></li> <li class="menu-item menu-item-type-custom menu-item-object-custom menu-item-39"><a href='http://www.v2automation.ie/#about' data-level='1'><span class="menu-item-text"><span class="menu-text">About</span></span></a></li> <li class="menu-item menu-item-type-custom menu-item-object-custom menu-item-40"><a href='http://www.v2automation.ie/#contact' data-level='1'><span class="menu-item-text"><span class="menu-text">Contact us</span></span></a></li> </ul>
		
	</header>

</div><div class='dt-close-mobile-menu-icon'><span></span></div>
<div class='dt-mobile-header'>
	<ul id="mobile-menu" class="mobile-main-nav" role="menu">
		<li class="menu-item menu-item-type-post_type menu-item-object-page menu-item-home current-menu-item page_item page-item-2 current_page_item menu-item-37 act first"><a href='https://v2automation.ie/' data-level='1'><span class="menu-item-text"><span class="menu-text">Home</span></span></a></li> <li class="menu-item menu-item-type-custom menu-item-object-custom menu-item-38"><a href='http://www.v2automation.ie/#products' data-level='1'><span class="menu-item-text"><span class="menu-text">Products</span></span></a></li> <li class="menu-item menu-item-type-custom menu-item-object-custom menu-item-39"><a href='http://www.v2automation.ie/#about' data-level='1'><span class="menu-item-text"><span class="menu-text">About</span></span></a></li> <li class="menu-item menu-item-type-custom menu-item-object-custom menu-item-40"><a href='http://www.v2automation.ie/#contact' data-level='1'><span class="menu-item-text"><span class="menu-text">Contact us</span></span></a></li> 	</ul>
	<div class='mobile-mini-widgets-in-menu'></div>
</div>
<div id="main-slideshow">
<div id="rev_slider_1_1_wrapper" class="rev_slider_wrapper fullwidthbanner-container" data-source="gallery" style="margin:0px auto;background:transparent;padding:0px;margin-top:0px;margin-bottom:0px;">
<!-- START REVOLUTION SLIDER 5.4.8.2 auto mode -->
	<div id="rev_slider_1_1" class="rev_slider fullwidthabanner" style="display:none;" data-version="5.4.8.2">
<ul>	<!-- SLIDE  -->
	<li data-index="rs-1" data-transition="fade" data-slotamount="default" data-hideafterloop="0" data-hideslideonmobile="off"  data-easein="default" data-easeout="default" data-masterspeed="300"  data-rotate="0"  data-saveperformance="off"  data-title="Slide" data-param1="" data-param2="" data-param3="" data-param4="" data-param5="" data-param6="" data-param7="" data-param8="" data-param9="" data-param10="" data-description="">
		<!-- MAIN IMAGE -->
		<img src="https://v2automation.ie/wp-content/uploads/2018/07/background-1.png"  alt="" title="background"  width="1155" height="651" data-bgposition="center center" data-bgfit="cover" data-bgparallax="5" class="rev-slidebg" data-no-retina>
		<!-- LAYERS -->

		<!-- BACKGROUND VIDEO LAYER -->
		<div class="rs-background-video-layer" 
			data-forcerewind="on" 
			data-volume="mute" 
			data-videowidth="100%" 
			data-videoheight="100%" 
			data-videoogv="/wp-content/uploads/2018/07/Welcome-to-V2-the-leader-manufacturing-company-for-automation-solutions.mp4" 
			data-videowebm="/wp-content/uploads/2018/07/Welcome-to-V2-the-leader-manufacturing-company-for-automation-solutions.mp4" 
			data-videomp4="/wp-content/uploads/2018/07/Welcome-to-V2-the-leader-manufacturing-company-for-automation-solutions.mp4" 
			data-videopreload="auto" 
			data-videoloop="loopandnoslidestop" 
			data-forceCover="1" 
			data-aspectratio="16:9" 
			data-autoplay="true" 
			data-autoplayonlyfirsttime="false" 
></div>	</li>
</ul>
<div class="tp-bannertimer tp-bottom" style="visibility: hidden !important;"></div>	</div>
<script>var htmlDiv = document.getElementById("rs-plugin-settings-inline-css"); var htmlDivCss="";
				if(htmlDiv) {
					htmlDiv.innerHTML = htmlDiv.innerHTML + htmlDivCss;
				}else{
					var htmlDiv = document.createElement("div");
					htmlDiv.innerHTML = "<style>" + htmlDivCss + "</style>";
					document.getElementsByTagName("head")[0].appendChild(htmlDiv.childNodes[0]);
				}
			</script>
		<script type="text/javascript">
if (setREVStartSize!==undefined) setREVStartSize(
	{c: '#rev_slider_1_1', gridwidth: [1240], gridheight: [868], sliderLayout: 'auto'});
			
var revapi1,
	tpj;	
(function() {			
	if (!/loaded|interactive|complete/.test(document.readyState)) document.addEventListener("DOMContentLoaded",onLoad); else onLoad();	
	function onLoad() {				
		if (tpj===undefined) { tpj = jQuery; if("off" == "on") tpj.noConflict();}
	if(tpj("#rev_slider_1_1").revolution == undefined){
		revslider_showDoubleJqueryError("#rev_slider_1_1");
	}else{
		revapi1 = tpj("#rev_slider_1_1").show().revolution({
			sliderType:"hero",
			jsFileLocation:"//v2automation.ie/wp-content/plugins/revslider/public/assets/js/",
			sliderLayout:"auto",
			dottedOverlay:"none",
			delay:9000,
			visibilityLevels:[1240,1024,778,480],
			gridwidth:1240,
			gridheight:868,
			lazyType:"none",
			parallax: {
				type:"mouse",
				origo:"enterpoint",
				speed:400,
				speedbg:0,
				speedls:0,
				levels:[5,10,15,20,25,30,35,40,45,46,47,48,49,50,51,55],
			},
			shadow:0,
			spinner:"spinner0",
			autoHeight:"off",
			disableProgressBar:"on",
			hideThumbsOnMobile:"off",
			hideSliderAtLimit:0,
			hideCaptionAtLimit:0,
			hideAllCaptionAtLilmit:0,
			debugMode:false,
			fallbacks: {
				simplifyAll:"off",
				disableFocusListener:false,
			}
		});
	}; /* END OF revapi call */
	
 }; /* END OF ON LOAD FUNCTION */
}()); /* END OF WRAPPING FUNCTION */
</script>
		</div><!-- END REVOLUTION SLIDER --></div>

<div id="main" class="sidebar-none sidebar-divider-off"  >

	
    <div class="main-gradient"></div>
    <div class="wf-wrap">
    <div class="wf-container-main">

	


    <div id="content" class="content" role="main">

		<div id="products" class="vc_row wpb_row vc_row-fluid"><div class="wpb_column vc_column_container vc_col-sm-12"><div class="vc_column-inner "><div class="wpb_wrapper"><h2 style="text-align: center;font-family:Oswald;font-weight:400;font-style:normal" class="vc_custom_heading" >V2 Products</h2><h3 style="text-align: center;font-family:Oswald;font-weight:400;font-style:normal" class="vc_custom_heading" >Take a look at the products you are able to purchase from Auto Entry Systems</h3></div></div></div></div><div data-vc-full-width="true" data-vc-full-width-init="false" data-vc-stretch-content="true" class="vc_row wpb_row vc_row-fluid"><div class="wpb_column vc_column_container vc_col-sm-4 vc_col-has-fill"><div class="vc_column-inner vc_custom_1517072009069"><div class="wpb_wrapper"><div id="ultimate-heading-21495c6a1d85df638" class="uvc-heading ult-adjust-bottom-margin ultimate-heading-21495c6a1d85df638 uvc-4745 " data-hspacer="no_spacer"  data-halign="center" style="text-align:center"><div class="uvc-heading-spacer no_spacer" style="top"></div><div class="uvc-main-heading ult-responsive"  data-ultimate-target='.uvc-heading.ultimate-heading-21495c6a1d85df638 h2'  data-responsive-json-new='{"font-size":"","line-height":""}' ><h2 style="font-family:&#039;Open Sans&#039;;font-weight:800;color:#e0001a;">Alfariss</h2></div><div class="uvc-sub-heading ult-responsive"  data-ultimate-target='.uvc-heading.ultimate-heading-21495c6a1d85df638 .uvc-sub-heading '  data-responsive-json-new='{"font-size":"","line-height":""}'  style="font-family:&#039;Open Sans&#039;;font-weight:600;">24V irreversible electromechanical rack actuator motor reducer for sliding gates weighing up to 300 kg</div></div>
	<div  class="wpb_single_image wpb_content_element vc_align_center  wpb_animate_when_almost_visible wpb_fadeInDown fadeInDown">
		
		<figure class="wpb_wrapper vc_figure">
			<a href="https://v2automation.ie/wp-content/uploads/2018/07/ALFARISS.png" target="_self"  class="vc_single_image-wrapper   vc_box_border_grey dt-pswp-item rollover rollover-zoom" data-large_image_width="200" data-large_image_height = "200"     ><img width="200" height="200" src="https://v2automation.ie/wp-content/uploads/2018/07/ALFARISS.png" class="vc_single_image-img attachment-medium" alt="" srcset="https://v2automation.ie/wp-content/uploads/2018/07/ALFARISS.png 200w, https://v2automation.ie/wp-content/uploads/2018/07/ALFARISS-150x150.png 150w" sizes="(max-width: 200px) 100vw, 200px"  data-dt-location="https://v2automation.ie/sample-page/alfariss/" /></a>
		</figure>
	</div>
<style type="text/css" data-type="the7_shortcodes-inline-css">#default-btn-c76d81f4b9893f8de3b59f6ee287cfd6:not(:hover) {
  background: #dd3333 !important;
  color: #ffffff;
}
#default-btn-c76d81f4b9893f8de3b59f6ee287cfd6:not(:hover) * {
  color: #ffffff;
}
.btn-3d #default-btn-c76d81f4b9893f8de3b59f6ee287cfd6:not(:hover) {
  border-bottom-color: #a03333;
}
#default-btn-c76d81f4b9893f8de3b59f6ee287cfd6:hover {
  background: #ffffff !important;
  color: #dd3333;
}
#default-btn-c76d81f4b9893f8de3b59f6ee287cfd6:hover * {
  color: #dd3333;
}
.btn-3d #default-btn-c76d81f4b9893f8de3b59f6ee287cfd6:hover {
  border-bottom-color: #e0e0e0;
}
#default-btn-c76d81f4b9893f8de3b59f6ee287cfd6 > i {
  font-size: 11px;
}
#default-btn-c76d81f4b9893f8de3b59f6ee287cfd6 * {
  vertical-align: middle;
}
</style><div class="btn-align-center"><a href="http://www.v2elettronica.com/img_prodotti/manuali/1508920988_ALFARISS_ZIS285_25.10.2016.pdf" class="default-btn-shortcode dt-btn dt-btn-s " target="_blank" id="default-btn-c76d81f4b9893f8de3b59f6ee287cfd6" title="Manual"><span>Manual</span></a></div><div class="ult-spacer spacer-5c6a1d85e1155" data-id="5c6a1d85e1155" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div></div></div></div><div class="wpb_column vc_column_container vc_col-sm-4"><div class="vc_column-inner "><div class="wpb_wrapper"><div id="ultimate-heading-67395c6a1d85e1c5d" class="uvc-heading ult-adjust-bottom-margin ultimate-heading-67395c6a1d85e1c5d uvc-4024 " data-hspacer="no_spacer"  data-halign="center" style="text-align:center"><div class="uvc-heading-spacer no_spacer" style="top"></div><div class="uvc-main-heading ult-responsive"  data-ultimate-target='.uvc-heading.ultimate-heading-67395c6a1d85e1c5d h2'  data-responsive-json-new='{"font-size":"","line-height":""}' ><h2 style="font-family:&#039;Open Sans&#039;;font-weight:800;color:#e0001a;">Axil</h2></div><div class="uvc-sub-heading ult-responsive"  data-ultimate-target='.uvc-heading.ultimate-heading-67395c6a1d85e1c5d .uvc-sub-heading '  data-responsive-json-new='{"font-size":"","line-height":""}'  style="font-family:&#039;Open Sans&#039;;font-weight:600;">230V and 24V irreversible electromechanical actuator for swing gates with leaves up to 2.8 m in length</div></div>
	<div  class="wpb_single_image wpb_content_element vc_align_center  wpb_animate_when_almost_visible wpb_fadeInDown fadeInDown">
		
		<figure class="wpb_wrapper vc_figure">
			<a href="https://v2automation.ie/wp-content/uploads/2018/07/AXIL.png" target="_self"  class="vc_single_image-wrapper   vc_box_border_grey dt-pswp-item rollover rollover-zoom" data-large_image_width="200" data-large_image_height = "200"     ><img width="200" height="200" src="https://v2automation.ie/wp-content/uploads/2018/07/AXIL.png" class="vc_single_image-img attachment-medium" alt="" srcset="https://v2automation.ie/wp-content/uploads/2018/07/AXIL.png 200w, https://v2automation.ie/wp-content/uploads/2018/07/AXIL-150x150.png 150w" sizes="(max-width: 200px) 100vw, 200px"  data-dt-location="https://v2automation.ie/sample-page/axil/" /></a>
		</figure>
	</div>
<style type="text/css" data-type="the7_shortcodes-inline-css">#default-btn-94eacc977594e35714789ae370a27e5c:not(:hover) {
  background: #dd3333 !important;
  color: #ffffff;
}
#default-btn-94eacc977594e35714789ae370a27e5c:not(:hover) * {
  color: #ffffff;
}
.btn-3d #default-btn-94eacc977594e35714789ae370a27e5c:not(:hover) {
  border-bottom-color: #a03333;
}
#default-btn-94eacc977594e35714789ae370a27e5c:hover {
  background: #ffffff !important;
  color: #dd3333;
}
#default-btn-94eacc977594e35714789ae370a27e5c:hover * {
  color: #dd3333;
}
.btn-3d #default-btn-94eacc977594e35714789ae370a27e5c:hover {
  border-bottom-color: #e0e0e0;
}
#default-btn-94eacc977594e35714789ae370a27e5c > i {
  font-size: 11px;
}
#default-btn-94eacc977594e35714789ae370a27e5c * {
  vertical-align: middle;
}
</style><div class="btn-align-center"><a href="http://www.v2elettronica.com/img_prodotti/manuali/1510068087_AXIL_IL290_08.03.2016.pdf" class="default-btn-shortcode dt-btn dt-btn-s " target="_blank" id="default-btn-94eacc977594e35714789ae370a27e5c" title="Manual"><span>Manual</span></a></div><div class="ult-spacer spacer-5c6a1d85e3133" data-id="5c6a1d85e3133" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div></div></div></div><div class="wpb_column vc_column_container vc_col-sm-4 vc_col-has-fill"><div class="vc_column-inner vc_custom_1517072022060"><div class="wpb_wrapper"><div id="ultimate-heading-67555c6a1d85e3818" class="uvc-heading ult-adjust-bottom-margin ultimate-heading-67555c6a1d85e3818 uvc-951 " data-hspacer="no_spacer"  data-halign="center" style="text-align:center"><div class="uvc-heading-spacer no_spacer" style="top"></div><div class="uvc-main-heading ult-responsive"  data-ultimate-target='.uvc-heading.ultimate-heading-67555c6a1d85e3818 h2'  data-responsive-json-new='{"font-size":"","line-height":""}' ><h2 style="font-family:&#039;Open Sans&#039;;font-weight:800;color:#e0001a;">Ayros</h2></div><div class="uvc-sub-heading ult-responsive"  data-ultimate-target='.uvc-heading.ultimate-heading-67555c6a1d85e3818 .uvc-sub-heading '  data-responsive-json-new='{"font-size":"","line-height":""}'  style="font-family:&#039;Open Sans&#039;;font-weight:600;">230V irreversible electromechanical rack actuator motor reducer for sliding gates weighing up to 1500 kg</div></div>
	<div  class="wpb_single_image wpb_content_element vc_align_center  wpb_animate_when_almost_visible wpb_fadeInDown fadeInDown">
		
		<figure class="wpb_wrapper vc_figure">
			<a href="https://v2automation.ie/wp-content/uploads/2018/07/AYROS.png" target="_self"  class="vc_single_image-wrapper   vc_box_border_grey dt-pswp-item rollover rollover-zoom" data-large_image_width="200" data-large_image_height = "200"     ><img width="200" height="200" src="https://v2automation.ie/wp-content/uploads/2018/07/AYROS.png" class="vc_single_image-img attachment-medium" alt="" srcset="https://v2automation.ie/wp-content/uploads/2018/07/AYROS.png 200w, https://v2automation.ie/wp-content/uploads/2018/07/AYROS-150x150.png 150w" sizes="(max-width: 200px) 100vw, 200px"  data-dt-location="https://v2automation.ie/sample-page/ayros/" /></a>
		</figure>
	</div>
<div class="vc_row wpb_row vc_inner vc_row-fluid"><div class="wpb_column vc_column_container vc_col-sm-4"><div class="vc_column-inner "><div class="wpb_wrapper"><div class="ult-spacer spacer-5c6a1d85e6ad2" data-id="5c6a1d85e6ad2" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div><style type="text/css" data-type="the7_shortcodes-inline-css">#default-btn-a4b950c63430f7cf1bb8c5bab343c0cb:not(:hover) {
  background: #dd3333 !important;
  color: #ffffff;
}
#default-btn-a4b950c63430f7cf1bb8c5bab343c0cb:not(:hover) * {
  color: #ffffff;
}
.btn-3d #default-btn-a4b950c63430f7cf1bb8c5bab343c0cb:not(:hover) {
  border-bottom-color: #a03333;
}
#default-btn-a4b950c63430f7cf1bb8c5bab343c0cb:hover {
  background: #ffffff !important;
  color: #dd3333;
}
#default-btn-a4b950c63430f7cf1bb8c5bab343c0cb:hover * {
  color: #dd3333;
}
.btn-3d #default-btn-a4b950c63430f7cf1bb8c5bab343c0cb:hover {
  border-bottom-color: #e0e0e0;
}
#default-btn-a4b950c63430f7cf1bb8c5bab343c0cb > i {
  font-size: 11px;
}
#default-btn-a4b950c63430f7cf1bb8c5bab343c0cb * {
  vertical-align: middle;
}
</style><div class="btn-align-center"><a href="http://www.v2elettronica.com/img_prodotti/manuali/1517230162_AYROS_ZIS332_01.09.2017.pdf" class="default-btn-shortcode dt-btn dt-btn-s " target="_blank" id="default-btn-a4b950c63430f7cf1bb8c5bab343c0cb" title="Manual"><span>Manual</span></a></div><div class="ult-spacer spacer-5c6a1d85e6d51" data-id="5c6a1d85e6d51" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div></div></div></div><div class="wpb_column vc_column_container vc_col-sm-4"><div class="vc_column-inner "><div class="wpb_wrapper"><div class="ult-spacer spacer-5c6a1d85e70ff" data-id="5c6a1d85e70ff" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div><style type="text/css" data-type="the7_shortcodes-inline-css">#default-btn-79e8735d6f2d7274b05ea44c1e0d10d0:not(:hover) {
  background: #dd3333 !important;
  color: #ffffff;
}
#default-btn-79e8735d6f2d7274b05ea44c1e0d10d0:not(:hover) * {
  color: #ffffff;
}
.btn-3d #default-btn-79e8735d6f2d7274b05ea44c1e0d10d0:not(:hover) {
  border-bottom-color: #a03333;
}
#default-btn-79e8735d6f2d7274b05ea44c1e0d10d0:hover {
  background: #ffffff !important;
  color: #dd3333;
}
#default-btn-79e8735d6f2d7274b05ea44c1e0d10d0:hover * {
  color: #dd3333;
}
.btn-3d #default-btn-79e8735d6f2d7274b05ea44c1e0d10d0:hover {
  border-bottom-color: #e0e0e0;
}
#default-btn-79e8735d6f2d7274b05ea44c1e0d10d0 > i {
  font-size: 11px;
}
#default-btn-79e8735d6f2d7274b05ea44c1e0d10d0 * {
  vertical-align: middle;
}
</style><div class="btn-align-center"><a href="http://www.v2elettronica.com/img_prodotti/manuali/1509965570_AYROS-24V_ZIS334_02.02.2017.pdf" class="default-btn-shortcode dt-btn dt-btn-s " target="_blank" id="default-btn-79e8735d6f2d7274b05ea44c1e0d10d0" title="Manual"><span>Manual 24v</span></a></div><div class="ult-spacer spacer-5c6a1d85e7308" data-id="5c6a1d85e7308" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div></div></div></div><div class="wpb_column vc_column_container vc_col-sm-4"><div class="vc_column-inner "><div class="wpb_wrapper"><div class="ult-spacer spacer-5c6a1d85e76d3" data-id="5c6a1d85e76d3" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div><style type="text/css" data-type="the7_shortcodes-inline-css">#default-btn-9d0f7f3285d522ccdf69ce74d25a4373:not(:hover) {
  background: #dd3333 !important;
  color: #ffffff;
}
#default-btn-9d0f7f3285d522ccdf69ce74d25a4373:not(:hover) * {
  color: #ffffff;
}
.btn-3d #default-btn-9d0f7f3285d522ccdf69ce74d25a4373:not(:hover) {
  border-bottom-color: #a03333;
}
#default-btn-9d0f7f3285d522ccdf69ce74d25a4373:hover {
  background: #ffffff !important;
  color: #dd3333;
}
#default-btn-9d0f7f3285d522ccdf69ce74d25a4373:hover * {
  color: #dd3333;
}
.btn-3d #default-btn-9d0f7f3285d522ccdf69ce74d25a4373:hover {
  border-bottom-color: #e0e0e0;
}
#default-btn-9d0f7f3285d522ccdf69ce74d25a4373 > i {
  font-size: 11px;
}
#default-btn-9d0f7f3285d522ccdf69ce74d25a4373 * {
  vertical-align: middle;
}
</style><div class="btn-align-center"><a href="http://www.v2elettronica.com/img_prodotti/manuali/1517230162_AYROS1500-I_ZIS442_19.09.2017.pdf" class="default-btn-shortcode dt-btn dt-btn-s " target="_blank" id="default-btn-9d0f7f3285d522ccdf69ce74d25a4373" title="Manual"><span>Manual 1500l</span></a></div><div class="ult-spacer spacer-5c6a1d85e7927" data-id="5c6a1d85e7927" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div></div></div></div></div></div></div></div></div><div class="vc_row-full-width vc_clearfix"></div><!-- Row Backgrounds --><div class="upb_color" data-bg-override="ex-full" data-bg-color="rgba(221,51,51,0.06)" data-fadeout="" data-fadeout-percentage="30" data-parallax-content="" data-parallax-content-sense="30" data-row-effect-mobile-disable="true" data-img-parallax-mobile-disable="true" data-rtl="false"  data-custom-vc-row=""  data-vc="5.5.2"  data-is_old_vc=""  data-theme-support=""   data-overlay="false" data-overlay-color="" data-overlay-pattern="" data-overlay-pattern-opacity="" data-overlay-pattern-size=""    ></div><div data-vc-full-width="true" data-vc-full-width-init="false" data-vc-stretch-content="true" class="vc_row wpb_row vc_row-fluid"><div class="wpb_column vc_column_container vc_col-sm-4"><div class="vc_column-inner "><div class="wpb_wrapper"><div id="ultimate-heading-98405c6a1d85e871b" class="uvc-heading ult-adjust-bottom-margin ultimate-heading-98405c6a1d85e871b uvc-8586 " data-hspacer="no_spacer"  data-halign="center" style="text-align:center"><div class="uvc-heading-spacer no_spacer" style="top"></div><div class="uvc-main-heading ult-responsive"  data-ultimate-target='.uvc-heading.ultimate-heading-98405c6a1d85e871b h2'  data-responsive-json-new='{"font-size":"","line-height":""}' ><h2 style="font-family:&#039;Open Sans&#039;;font-weight:800;color:#e0001a;">Bingo</h2></div><div class="uvc-sub-heading ult-responsive"  data-ultimate-target='.uvc-heading.ultimate-heading-98405c6a1d85e871b .uvc-sub-heading '  data-responsive-json-new='{"font-size":"","line-height":""}'  style="font-family:&#039;Open Sans&#039;;font-weight:600;">230V and 24V irreversible electromechanical actuator for swing gates with leaves up to 5 m in length</div></div>
	<div  class="wpb_single_image wpb_content_element vc_align_center  wpb_animate_when_almost_visible wpb_fadeInDown fadeInDown">
		
		<figure class="wpb_wrapper vc_figure">
			<a href="https://v2automation.ie/wp-content/uploads/2018/07/BINGO.png" target="_self"  class="vc_single_image-wrapper   vc_box_border_grey dt-pswp-item rollover rollover-zoom" data-large_image_width="200" data-large_image_height = "200"     ><img width="200" height="200" src="https://v2automation.ie/wp-content/uploads/2018/07/BINGO.png" class="vc_single_image-img attachment-medium" alt="" srcset="https://v2automation.ie/wp-content/uploads/2018/07/BINGO.png 200w, https://v2automation.ie/wp-content/uploads/2018/07/BINGO-150x150.png 150w" sizes="(max-width: 200px) 100vw, 200px"  data-dt-location="https://v2automation.ie/sample-page/bingo/" /></a>
		</figure>
	</div>
<div class="ult-spacer spacer-5c6a1d85e971b" data-id="5c6a1d85e971b" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div><style type="text/css" data-type="the7_shortcodes-inline-css">#default-btn-7cfce1aa714a46ca5b22087c6dc7a752:not(:hover) {
  background: #dd3333 !important;
  color: #ffffff;
}
#default-btn-7cfce1aa714a46ca5b22087c6dc7a752:not(:hover) * {
  color: #ffffff;
}
.btn-3d #default-btn-7cfce1aa714a46ca5b22087c6dc7a752:not(:hover) {
  border-bottom-color: #a03333;
}
#default-btn-7cfce1aa714a46ca5b22087c6dc7a752:hover {
  background: #ffffff !important;
  color: #dd3333;
}
#default-btn-7cfce1aa714a46ca5b22087c6dc7a752:hover * {
  color: #dd3333;
}
.btn-3d #default-btn-7cfce1aa714a46ca5b22087c6dc7a752:hover {
  border-bottom-color: #e0e0e0;
}
#default-btn-7cfce1aa714a46ca5b22087c6dc7a752 > i {
  font-size: 11px;
}
#default-btn-7cfce1aa714a46ca5b22087c6dc7a752 * {
  vertical-align: middle;
}
</style><div class="btn-align-center"><a href="http://www.v2elettronica.com/img_prodotti/manuali/1355739456_BINGO_131_28.08.2012.pdf" class="default-btn-shortcode dt-btn dt-btn-s " target="_blank" id="default-btn-7cfce1aa714a46ca5b22087c6dc7a752" title="Manual"><span>Manual</span></a></div><div class="ult-spacer spacer-5c6a1d85e99c7" data-id="5c6a1d85e99c7" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div></div></div></div><div class="wpb_column vc_column_container vc_col-sm-4 vc_col-has-fill"><div class="vc_column-inner vc_custom_1532135010546"><div class="wpb_wrapper"><div id="ultimate-heading-36175c6a1d85ea1b5" class="uvc-heading ult-adjust-bottom-margin ultimate-heading-36175c6a1d85ea1b5 uvc-5787 " data-hspacer="no_spacer"  data-halign="center" style="text-align:center"><div class="uvc-heading-spacer no_spacer" style="top"></div><div class="uvc-main-heading ult-responsive"  data-ultimate-target='.uvc-heading.ultimate-heading-36175c6a1d85ea1b5 h2'  data-responsive-json-new='{"font-size":"","line-height":""}' ><h2 style="font-family:&#039;Open Sans&#039;;font-weight:800;color:#e0001a;">Blitz</h2></div><div class="uvc-sub-heading ult-responsive"  data-ultimate-target='.uvc-heading.ultimate-heading-36175c6a1d85ea1b5 .uvc-sub-heading '  data-responsive-json-new='{"font-size":"","line-height":""}'  style="font-family:&#039;Open Sans&#039;;font-weight:600;">230V and 24V irreversible electromechanical pivoting arm actuator for swing gates with leaves up to 3 m</div></div>
	<div  class="wpb_single_image wpb_content_element vc_align_center  wpb_animate_when_almost_visible wpb_fadeInDown fadeInDown">
		
		<figure class="wpb_wrapper vc_figure">
			<a href="https://v2automation.ie/wp-content/uploads/2018/07/BLITZ.png" target="_self"  class="vc_single_image-wrapper   vc_box_border_grey dt-pswp-item rollover rollover-zoom" data-large_image_width="200" data-large_image_height = "200"     ><img width="200" height="200" src="https://v2automation.ie/wp-content/uploads/2018/07/BLITZ.png" class="vc_single_image-img attachment-medium" alt="" srcset="https://v2automation.ie/wp-content/uploads/2018/07/BLITZ.png 200w, https://v2automation.ie/wp-content/uploads/2018/07/BLITZ-150x150.png 150w" sizes="(max-width: 200px) 100vw, 200px"  data-dt-location="https://v2automation.ie/sample-page/blitz/" /></a>
		</figure>
	</div>
<div class="ult-spacer spacer-5c6a1d85eb89b" data-id="5c6a1d85eb89b" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div><style type="text/css" data-type="the7_shortcodes-inline-css">#default-btn-bb20824125c3231f1d4b81b64602fd91:not(:hover) {
  background: #dd3333 !important;
  color: #ffffff;
}
#default-btn-bb20824125c3231f1d4b81b64602fd91:not(:hover) * {
  color: #ffffff;
}
.btn-3d #default-btn-bb20824125c3231f1d4b81b64602fd91:not(:hover) {
  border-bottom-color: #a03333;
}
#default-btn-bb20824125c3231f1d4b81b64602fd91:hover {
  background: #ffffff !important;
  color: #dd3333;
}
#default-btn-bb20824125c3231f1d4b81b64602fd91:hover * {
  color: #dd3333;
}
.btn-3d #default-btn-bb20824125c3231f1d4b81b64602fd91:hover {
  border-bottom-color: #e0e0e0;
}
#default-btn-bb20824125c3231f1d4b81b64602fd91 > i {
  font-size: 11px;
}
#default-btn-bb20824125c3231f1d4b81b64602fd91 * {
  vertical-align: middle;
}
</style><div class="btn-align-center"><a href="http://www.v2elettronica.com/img_prodotti/manuali/1355739796_BLITZ_159_26.11.09.pdf" class="default-btn-shortcode dt-btn dt-btn-s " target="_blank" id="default-btn-bb20824125c3231f1d4b81b64602fd91" title="Manual"><span>Manual</span></a></div><div class="ult-spacer spacer-5c6a1d85ebe2d" data-id="5c6a1d85ebe2d" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div></div></div></div><div class="wpb_column vc_column_container vc_col-sm-4"><div class="vc_column-inner "><div class="wpb_wrapper"><div id="ultimate-heading-47935c6a1d85ecc67" class="uvc-heading ult-adjust-bottom-margin ultimate-heading-47935c6a1d85ecc67 uvc-9203 " data-hspacer="no_spacer"  data-halign="center" style="text-align:center"><div class="uvc-heading-spacer no_spacer" style="top"></div><div class="uvc-main-heading ult-responsive"  data-ultimate-target='.uvc-heading.ultimate-heading-47935c6a1d85ecc67 h2'  data-responsive-json-new='{"font-size":"","line-height":""}' ><h2 style="font-family:&#039;Open Sans&#039;;font-weight:800;color:#e0001a;">Calypso</h2></div><div class="uvc-sub-heading ult-responsive"  data-ultimate-target='.uvc-heading.ultimate-heading-47935c6a1d85ecc67 .uvc-sub-heading '  data-responsive-json-new='{"font-size":"","line-height":""}'  style="font-family:&#039;Open Sans&#039;;font-weight:600;">230V and 24V irreversible electromechanical actuator for swing gates with leaves up to 3 m in length</div></div>
	<div  class="wpb_single_image wpb_content_element vc_align_center  wpb_animate_when_almost_visible wpb_fadeInDown fadeInDown">
		
		<figure class="wpb_wrapper vc_figure">
			<a href="https://v2automation.ie/wp-content/uploads/2018/07/CALYPSO.png" target="_self"  class="vc_single_image-wrapper   vc_box_border_grey dt-pswp-item rollover rollover-zoom" data-large_image_width="200" data-large_image_height = "200"     ><img width="200" height="200" src="https://v2automation.ie/wp-content/uploads/2018/07/CALYPSO.png" class="vc_single_image-img attachment-medium" alt="" srcset="https://v2automation.ie/wp-content/uploads/2018/07/CALYPSO.png 200w, https://v2automation.ie/wp-content/uploads/2018/07/CALYPSO-150x150.png 150w" sizes="(max-width: 200px) 100vw, 200px"  data-dt-location="https://v2automation.ie/sample-page/calypso/" /></a>
		</figure>
	</div>
<div class="ult-spacer spacer-5c6a1d85ee6cd" data-id="5c6a1d85ee6cd" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div><style type="text/css" data-type="the7_shortcodes-inline-css">#default-btn-6a2a91c23232bb7883667e022ec50245:not(:hover) {
  background: #dd3333 !important;
  color: #ffffff;
}
#default-btn-6a2a91c23232bb7883667e022ec50245:not(:hover) * {
  color: #ffffff;
}
.btn-3d #default-btn-6a2a91c23232bb7883667e022ec50245:not(:hover) {
  border-bottom-color: #a03333;
}
#default-btn-6a2a91c23232bb7883667e022ec50245:hover {
  background: #ffffff !important;
  color: #dd3333;
}
#default-btn-6a2a91c23232bb7883667e022ec50245:hover * {
  color: #dd3333;
}
.btn-3d #default-btn-6a2a91c23232bb7883667e022ec50245:hover {
  border-bottom-color: #e0e0e0;
}
#default-btn-6a2a91c23232bb7883667e022ec50245 > i {
  font-size: 11px;
}
#default-btn-6a2a91c23232bb7883667e022ec50245 * {
  vertical-align: middle;
}
</style><div class="btn-align-center"><a href="http://www.v2elettronica.com/img_prodotti/manuali/1476106887_CALYPSO_IL186_16.02.2016.pdf" class="default-btn-shortcode dt-btn dt-btn-s " target="_blank" id="default-btn-6a2a91c23232bb7883667e022ec50245" title="Manual"><span>Manual</span></a></div><div class="ult-spacer spacer-5c6a1d85eec5a" data-id="5c6a1d85eec5a" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div></div></div></div></div><div class="vc_row-full-width vc_clearfix"></div><!-- Row Backgrounds --><div class="upb_color" data-bg-override="ex-full" data-bg-color="rgba(221,51,51,0.06)" data-fadeout="" data-fadeout-percentage="30" data-parallax-content="" data-parallax-content-sense="30" data-row-effect-mobile-disable="true" data-img-parallax-mobile-disable="true" data-rtl="false"  data-custom-vc-row=""  data-vc="5.5.2"  data-is_old_vc=""  data-theme-support=""   data-overlay="false" data-overlay-color="" data-overlay-pattern="" data-overlay-pattern-opacity="" data-overlay-pattern-size=""    ></div><div data-vc-full-width="true" data-vc-full-width-init="false" data-vc-stretch-content="true" class="vc_row wpb_row vc_row-fluid"><div class="wpb_column vc_column_container vc_col-sm-4 vc_col-has-fill"><div class="vc_column-inner vc_custom_1532135019816"><div class="wpb_wrapper"><div id="ultimate-heading-92855c6a1d85f06db" class="uvc-heading ult-adjust-bottom-margin ultimate-heading-92855c6a1d85f06db uvc-209 " data-hspacer="no_spacer"  data-halign="center" style="text-align:center"><div class="uvc-heading-spacer no_spacer" style="top"></div><div class="uvc-main-heading ult-responsive"  data-ultimate-target='.uvc-heading.ultimate-heading-92855c6a1d85f06db h2'  data-responsive-json-new='{"font-size":"","line-height":""}' ><h2 style="font-family:&#039;Open Sans&#039;;font-weight:800;color:#e0001a;">Ciclón</h2></div><div class="uvc-sub-heading ult-responsive"  data-ultimate-target='.uvc-heading.ultimate-heading-92855c6a1d85f06db .uvc-sub-heading '  data-responsive-json-new='{"font-size":"","line-height":""}'  style="font-family:&#039;Open Sans&#039;;font-weight:600;">230V irreversible electromechanical pivoting arm actuator for swing gates with leaves up to 2.5 m</div></div>
	<div  class="wpb_single_image wpb_content_element vc_align_center  wpb_animate_when_almost_visible wpb_fadeInDown fadeInDown">
		
		<figure class="wpb_wrapper vc_figure">
			<a href="https://v2automation.ie/wp-content/uploads/2018/07/CICLON.png" target="_self"  class="vc_single_image-wrapper   vc_box_border_grey dt-pswp-item rollover rollover-zoom" data-large_image_width="200" data-large_image_height = "200"     ><img width="200" height="200" src="https://v2automation.ie/wp-content/uploads/2018/07/CICLON.png" class="vc_single_image-img attachment-medium" alt="" srcset="https://v2automation.ie/wp-content/uploads/2018/07/CICLON.png 200w, https://v2automation.ie/wp-content/uploads/2018/07/CICLON-150x150.png 150w" sizes="(max-width: 200px) 100vw, 200px"  data-dt-location="https://v2automation.ie/sample-page/ciclon/" /></a>
		</figure>
	</div>
<div class="ult-spacer spacer-5c6a1d85f1f6a" data-id="5c6a1d85f1f6a" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div><style type="text/css" data-type="the7_shortcodes-inline-css">#default-btn-4000b6033e960f536f4670c2a6580532:not(:hover) {
  background: #dd3333 !important;
  color: #ffffff;
}
#default-btn-4000b6033e960f536f4670c2a6580532:not(:hover) * {
  color: #ffffff;
}
.btn-3d #default-btn-4000b6033e960f536f4670c2a6580532:not(:hover) {
  border-bottom-color: #a03333;
}
#default-btn-4000b6033e960f536f4670c2a6580532:hover {
  background: #ffffff !important;
  color: #dd3333;
}
#default-btn-4000b6033e960f536f4670c2a6580532:hover * {
  color: #dd3333;
}
.btn-3d #default-btn-4000b6033e960f536f4670c2a6580532:hover {
  border-bottom-color: #e0e0e0;
}
#default-btn-4000b6033e960f536f4670c2a6580532 > i {
  font-size: 11px;
}
#default-btn-4000b6033e960f536f4670c2a6580532 * {
  vertical-align: middle;
}
</style><div class="btn-align-center"><a href="http://www.v2elettronica.com/img_prodotti/manuali/1355739743_CICLON_366_28.03.2012.pdf" class="default-btn-shortcode dt-btn dt-btn-s " target="_blank" id="default-btn-4000b6033e960f536f4670c2a6580532" title="Manual"><span>Manual</span></a></div><div class="ult-spacer spacer-5c6a1d85f231b" data-id="5c6a1d85f231b" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div></div></div></div><div class="wpb_column vc_column_container vc_col-sm-4"><div class="vc_column-inner "><div class="wpb_wrapper"><div id="ultimate-heading-18195c6a1d85f2de0" class="uvc-heading ult-adjust-bottom-margin ultimate-heading-18195c6a1d85f2de0 uvc-6791 " data-hspacer="no_spacer"  data-halign="center" style="text-align:center"><div class="uvc-heading-spacer no_spacer" style="top"></div><div class="uvc-main-heading ult-responsive"  data-ultimate-target='.uvc-heading.ultimate-heading-18195c6a1d85f2de0 h2'  data-responsive-json-new='{"font-size":"","line-height":""}' ><h2 style="font-family:&#039;Open Sans&#039;;font-weight:800;color:#e0001a;">Forteco 2500-i</h2></div><div class="uvc-sub-heading ult-responsive"  data-ultimate-target='.uvc-heading.ultimate-heading-18195c6a1d85f2de0 .uvc-sub-heading '  data-responsive-json-new='{"font-size":"","line-height":""}'  style="font-family:&#039;Open Sans&#039;;font-weight:600;">230V irreversible electromechanical motor reducer for sliding gates weighing up to 2500 kg. INVERTER technology</div></div>
	<div  class="wpb_single_image wpb_content_element vc_align_center  wpb_animate_when_almost_visible wpb_fadeInDown fadeInDown">
		
		<figure class="wpb_wrapper vc_figure">
			<a href="https://v2automation.ie/wp-content/uploads/2018/07/FORTECO-2500-i-1.png" target="_self"  class="vc_single_image-wrapper   vc_box_border_grey dt-pswp-item rollover rollover-zoom" data-large_image_width="200" data-large_image_height = "200"     ><img width="200" height="200" src="https://v2automation.ie/wp-content/uploads/2018/07/FORTECO-2500-i-1.png" class="vc_single_image-img attachment-medium" alt="" srcset="https://v2automation.ie/wp-content/uploads/2018/07/FORTECO-2500-i-1.png 200w, https://v2automation.ie/wp-content/uploads/2018/07/FORTECO-2500-i-1-150x150.png 150w" sizes="(max-width: 200px) 100vw, 200px"  data-dt-location="https://v2automation.ie/sample-page/forteco-2500-i-1/" /></a>
		</figure>
	</div>
<div class="ult-spacer spacer-5c6a1d86004ea" data-id="5c6a1d86004ea" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div><style type="text/css" data-type="the7_shortcodes-inline-css">#default-btn-6f8c09ebf30111b7210bb3d2cde9620e:not(:hover) {
  background: #dd3333 !important;
  color: #ffffff;
}
#default-btn-6f8c09ebf30111b7210bb3d2cde9620e:not(:hover) * {
  color: #ffffff;
}
.btn-3d #default-btn-6f8c09ebf30111b7210bb3d2cde9620e:not(:hover) {
  border-bottom-color: #a03333;
}
#default-btn-6f8c09ebf30111b7210bb3d2cde9620e:hover {
  background: #ffffff !important;
  color: #dd3333;
}
#default-btn-6f8c09ebf30111b7210bb3d2cde9620e:hover * {
  color: #dd3333;
}
.btn-3d #default-btn-6f8c09ebf30111b7210bb3d2cde9620e:hover {
  border-bottom-color: #e0e0e0;
}
#default-btn-6f8c09ebf30111b7210bb3d2cde9620e > i {
  font-size: 11px;
}
#default-btn-6f8c09ebf30111b7210bb3d2cde9620e * {
  vertical-align: middle;
}
</style><div class="btn-align-center"><a href="http://www.v2elettronica.com/img_prodotti/manuali/1510067463_FORTECO%202500_ZIS327_19.09.2017.pdf" class="default-btn-shortcode dt-btn dt-btn-s " target="_blank" id="default-btn-6f8c09ebf30111b7210bb3d2cde9620e" title="Manual"><span>Manual</span></a></div><div class="ult-spacer spacer-5c6a1d8600873" data-id="5c6a1d8600873" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div></div></div></div><div class="wpb_column vc_column_container vc_col-sm-4 vc_col-has-fill"><div class="vc_column-inner vc_custom_1532135033274"><div class="wpb_wrapper"><div id="ultimate-heading-30575c6a1d860108a" class="uvc-heading ult-adjust-bottom-margin ultimate-heading-30575c6a1d860108a uvc-7133 " data-hspacer="no_spacer"  data-halign="center" style="text-align:center"><div class="uvc-heading-spacer no_spacer" style="top"></div><div class="uvc-main-heading ult-responsive"  data-ultimate-target='.uvc-heading.ultimate-heading-30575c6a1d860108a h2'  data-responsive-json-new='{"font-size":"","line-height":""}' ><h2 style="font-family:&#039;Open Sans&#039;;font-weight:800;color:#e0001a;">Forteco</h2></div><div class="uvc-sub-heading ult-responsive"  data-ultimate-target='.uvc-heading.ultimate-heading-30575c6a1d860108a .uvc-sub-heading '  data-responsive-json-new='{"font-size":"","line-height":""}'  style="font-family:&#039;Open Sans&#039;;font-weight:600;">230V irreversible electromechanical rack actuator motor reducer for sliding gates weighing up to 2200 kg</div></div>
	<div  class="wpb_single_image wpb_content_element vc_align_center  wpb_animate_when_almost_visible wpb_fadeInDown fadeInDown">
		
		<figure class="wpb_wrapper vc_figure">
			<a href="https://v2automation.ie/wp-content/uploads/2018/07/FORTECO.png" target="_self"  class="vc_single_image-wrapper   vc_box_border_grey dt-pswp-item rollover rollover-zoom" data-large_image_width="200" data-large_image_height = "200"     ><img width="200" height="200" src="https://v2automation.ie/wp-content/uploads/2018/07/FORTECO.png" class="vc_single_image-img attachment-medium" alt="" srcset="https://v2automation.ie/wp-content/uploads/2018/07/FORTECO.png 200w, https://v2automation.ie/wp-content/uploads/2018/07/FORTECO-150x150.png 150w" sizes="(max-width: 200px) 100vw, 200px"  data-dt-location="https://v2automation.ie/sample-page/forteco/" /></a>
		</figure>
	</div>
<div class="ult-spacer spacer-5c6a1d860201f" data-id="5c6a1d860201f" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div><style type="text/css" data-type="the7_shortcodes-inline-css">#default-btn-f401c4ae6e145a39df33dd31df4d6e9a:not(:hover) {
  background: #dd3333 !important;
  color: #ffffff;
}
#default-btn-f401c4ae6e145a39df33dd31df4d6e9a:not(:hover) * {
  color: #ffffff;
}
.btn-3d #default-btn-f401c4ae6e145a39df33dd31df4d6e9a:not(:hover) {
  border-bottom-color: #a03333;
}
#default-btn-f401c4ae6e145a39df33dd31df4d6e9a:hover {
  background: #ffffff !important;
  color: #dd3333;
}
#default-btn-f401c4ae6e145a39df33dd31df4d6e9a:hover * {
  color: #dd3333;
}
.btn-3d #default-btn-f401c4ae6e145a39df33dd31df4d6e9a:hover {
  border-bottom-color: #e0e0e0;
}
#default-btn-f401c4ae6e145a39df33dd31df4d6e9a > i {
  font-size: 11px;
}
#default-btn-f401c4ae6e145a39df33dd31df4d6e9a * {
  vertical-align: middle;
}
</style><div class="btn-align-center"><a href="http://www.v2elettronica.com/img_prodotti/manuali/1472114706_FORTECO_IL403-1_23.08.2016.pdf" class="default-btn-shortcode dt-btn dt-btn-s " target="_blank" id="default-btn-f401c4ae6e145a39df33dd31df4d6e9a" title="Manual"><span>Manual</span></a></div><div class="ult-spacer spacer-5c6a1d8602382" data-id="5c6a1d8602382" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div></div></div></div></div><div class="vc_row-full-width vc_clearfix"></div><!-- Row Backgrounds --><div class="upb_color" data-bg-override="ex-full" data-bg-color="rgba(221,51,51,0.06)" data-fadeout="" data-fadeout-percentage="30" data-parallax-content="" data-parallax-content-sense="30" data-row-effect-mobile-disable="true" data-img-parallax-mobile-disable="true" data-rtl="false"  data-custom-vc-row=""  data-vc="5.5.2"  data-is_old_vc=""  data-theme-support=""   data-overlay="false" data-overlay-color="" data-overlay-pattern="" data-overlay-pattern-opacity="" data-overlay-pattern-size=""    ></div><div data-vc-full-width="true" data-vc-full-width-init="false" data-vc-stretch-content="true" class="vc_row wpb_row vc_row-fluid"><div class="wpb_column vc_column_container vc_col-sm-4"><div class="vc_column-inner "><div class="wpb_wrapper"><div id="ultimate-heading-44785c6a1d86030c3" class="uvc-heading ult-adjust-bottom-margin ultimate-heading-44785c6a1d86030c3 uvc-9494 " data-hspacer="no_spacer"  data-halign="center" style="text-align:center"><div class="uvc-heading-spacer no_spacer" style="top"></div><div class="uvc-main-heading ult-responsive"  data-ultimate-target='.uvc-heading.ultimate-heading-44785c6a1d86030c3 h2'  data-responsive-json-new='{"font-size":"","line-height":""}' ><h2 style="font-family:&#039;Open Sans&#039;;font-weight:800;color:#e0001a;">Forteco-m</h2></div><div class="uvc-sub-heading ult-responsive"  data-ultimate-target='.uvc-heading.ultimate-heading-44785c6a1d86030c3 .uvc-sub-heading '  data-responsive-json-new='{"font-size":"","line-height":""}'  style="font-family:&#039;Open Sans&#039;;font-weight:600;">230V irreversible electromechanical rack actuator motor reducer. Aluminium cover.</div></div>
	<div  class="wpb_single_image wpb_content_element vc_align_center  wpb_animate_when_almost_visible wpb_fadeInDown fadeInDown">
		
		<figure class="wpb_wrapper vc_figure">
			<a href="https://v2automation.ie/wp-content/uploads/2018/07/FORTECO-M.png" target="_self"  class="vc_single_image-wrapper   vc_box_border_grey dt-pswp-item rollover rollover-zoom" data-large_image_width="200" data-large_image_height = "200"     ><img width="200" height="200" src="https://v2automation.ie/wp-content/uploads/2018/07/FORTECO-M.png" class="vc_single_image-img attachment-medium" alt="" srcset="https://v2automation.ie/wp-content/uploads/2018/07/FORTECO-M.png 200w, https://v2automation.ie/wp-content/uploads/2018/07/FORTECO-M-150x150.png 150w" sizes="(max-width: 200px) 100vw, 200px"  data-dt-location="https://v2automation.ie/sample-page/forteco-m/" /></a>
		</figure>
	</div>
<div class="vc_row wpb_row vc_inner vc_row-fluid"><div class="wpb_column vc_column_container vc_col-sm-6"><div class="vc_column-inner "><div class="wpb_wrapper"><div class="ult-spacer spacer-5c6a1d8604729" data-id="5c6a1d8604729" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div><style type="text/css" data-type="the7_shortcodes-inline-css">#default-btn-c007c4ddb00d718c51683105b6e8c2f7:not(:hover) {
  background: #dd3333 !important;
  color: #ffffff;
}
#default-btn-c007c4ddb00d718c51683105b6e8c2f7:not(:hover) * {
  color: #ffffff;
}
.btn-3d #default-btn-c007c4ddb00d718c51683105b6e8c2f7:not(:hover) {
  border-bottom-color: #a03333;
}
#default-btn-c007c4ddb00d718c51683105b6e8c2f7:hover {
  background: #ffffff !important;
  color: #dd3333;
}
#default-btn-c007c4ddb00d718c51683105b6e8c2f7:hover * {
  color: #dd3333;
}
.btn-3d #default-btn-c007c4ddb00d718c51683105b6e8c2f7:hover {
  border-bottom-color: #e0e0e0;
}
#default-btn-c007c4ddb00d718c51683105b6e8c2f7 > i {
  font-size: 11px;
}
#default-btn-c007c4ddb00d718c51683105b6e8c2f7 * {
  vertical-align: middle;
}
</style><div class="btn-align-center"><a href="http://www.v2elettronica.com/img_prodotti/manuali/1510067752_FORTECO_IL403-1_23.08.2016.pdf" class="default-btn-shortcode dt-btn dt-btn-s " target="_blank" id="default-btn-c007c4ddb00d718c51683105b6e8c2f7" title="Manual"><span>Manual</span></a></div><div class="ult-spacer spacer-5c6a1d86049bd" data-id="5c6a1d86049bd" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div></div></div></div><div class="wpb_column vc_column_container vc_col-sm-6"><div class="vc_column-inner "><div class="wpb_wrapper"><div class="ult-spacer spacer-5c6a1d8604dc1" data-id="5c6a1d8604dc1" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div><style type="text/css" data-type="the7_shortcodes-inline-css">#default-btn-2058260092651bfe40f84ff928efb10e:not(:hover) {
  background: #dd3333 !important;
  color: #ffffff;
}
#default-btn-2058260092651bfe40f84ff928efb10e:not(:hover) * {
  color: #ffffff;
}
.btn-3d #default-btn-2058260092651bfe40f84ff928efb10e:not(:hover) {
  border-bottom-color: #a03333;
}
#default-btn-2058260092651bfe40f84ff928efb10e:hover {
  background: #ffffff !important;
  color: #dd3333;
}
#default-btn-2058260092651bfe40f84ff928efb10e:hover * {
  color: #dd3333;
}
.btn-3d #default-btn-2058260092651bfe40f84ff928efb10e:hover {
  border-bottom-color: #e0e0e0;
}
#default-btn-2058260092651bfe40f84ff928efb10e > i {
  font-size: 11px;
}
#default-btn-2058260092651bfe40f84ff928efb10e * {
  vertical-align: middle;
}
</style><div class="btn-align-center"><a href="http://www.v2elettronica.com/img_prodotti/manuali/1510067631_FORTECO%202500_ZIS327_19.09.2017.pdf" class="default-btn-shortcode dt-btn dt-btn-s " target="_blank" id="default-btn-2058260092651bfe40f84ff928efb10e" title="Manual"><span>Manual 2500-l</span></a></div><div class="ult-spacer spacer-5c6a1d8604fd0" data-id="5c6a1d8604fd0" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div></div></div></div></div></div></div></div><div class="wpb_column vc_column_container vc_col-sm-4 vc_col-has-fill"><div class="vc_column-inner vc_custom_1532135112864"><div class="wpb_wrapper"><div id="ultimate-heading-59915c6a1d8605593" class="uvc-heading ult-adjust-bottom-margin ultimate-heading-59915c6a1d8605593 uvc-6380 " data-hspacer="no_spacer"  data-halign="center" style="text-align:center"><div class="uvc-heading-spacer no_spacer" style="top"></div><div class="uvc-main-heading ult-responsive"  data-ultimate-target='.uvc-heading.ultimate-heading-59915c6a1d8605593 h2'  data-responsive-json-new='{"font-size":"","line-height":""}' ><h2 style="font-family:&#039;Open Sans&#039;;font-weight:800;color:#e0001a;">Hyperfor</h2></div><div class="uvc-sub-heading ult-responsive"  data-ultimate-target='.uvc-heading.ultimate-heading-59915c6a1d8605593 .uvc-sub-heading '  data-responsive-json-new='{"font-size":"","line-height":""}'  style="font-family:&#039;Open Sans&#039;;font-weight:600;">Irreversible electromechanical rack actuator motor reducer for sliding gates weighing up to 4000 kg. Available in two versions 230V three-phase with inverter and 400V three-phase</div></div>
	<div  class="wpb_single_image wpb_content_element vc_align_center  wpb_animate_when_almost_visible wpb_fadeInDown fadeInDown">
		
		<figure class="wpb_wrapper vc_figure">
			<a href="https://v2automation.ie/wp-content/uploads/2018/07/FORTECO-2500-i-2.png" target="_self"  class="vc_single_image-wrapper   vc_box_border_grey dt-pswp-item rollover rollover-zoom" data-large_image_width="200" data-large_image_height = "200"     ><img width="200" height="200" src="https://v2automation.ie/wp-content/uploads/2018/07/FORTECO-2500-i-2.png" class="vc_single_image-img attachment-medium" alt="" srcset="https://v2automation.ie/wp-content/uploads/2018/07/FORTECO-2500-i-2.png 200w, https://v2automation.ie/wp-content/uploads/2018/07/FORTECO-2500-i-2-150x150.png 150w" sizes="(max-width: 200px) 100vw, 200px"  data-dt-location="https://v2automation.ie/sample-page/forteco-2500-i-2/" /></a>
		</figure>
	</div>
<div class="vc_row wpb_row vc_inner vc_row-fluid"><div class="wpb_column vc_column_container vc_col-sm-6"><div class="vc_column-inner "><div class="wpb_wrapper"><div class="ult-spacer spacer-5c6a1d8606b69" data-id="5c6a1d8606b69" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div><style type="text/css" data-type="the7_shortcodes-inline-css">#default-btn-9f97a6a93d831581c0826d9216783290:not(:hover) {
  background: #dd3333 !important;
  color: #ffffff;
}
#default-btn-9f97a6a93d831581c0826d9216783290:not(:hover) * {
  color: #ffffff;
}
.btn-3d #default-btn-9f97a6a93d831581c0826d9216783290:not(:hover) {
  border-bottom-color: #a03333;
}
#default-btn-9f97a6a93d831581c0826d9216783290:hover {
  background: #ffffff !important;
  color: #dd3333;
}
#default-btn-9f97a6a93d831581c0826d9216783290:hover * {
  color: #dd3333;
}
.btn-3d #default-btn-9f97a6a93d831581c0826d9216783290:hover {
  border-bottom-color: #e0e0e0;
}
#default-btn-9f97a6a93d831581c0826d9216783290 > i {
  font-size: 11px;
}
#default-btn-9f97a6a93d831581c0826d9216783290 * {
  vertical-align: middle;
}
</style><div class="btn-align-center"><a href="http://www.v2elettronica.com/img_prodotti/manuali/1489419685_HYPERFOR%204000_ZIS380_13.03.2017.pdf" class="default-btn-shortcode dt-btn dt-btn-s " target="_blank" id="default-btn-9f97a6a93d831581c0826d9216783290" title="Manual"><span>Manual</span></a></div><div class="ult-spacer spacer-5c6a1d8606e04" data-id="5c6a1d8606e04" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div></div></div></div><div class="wpb_column vc_column_container vc_col-sm-6"><div class="vc_column-inner "><div class="wpb_wrapper"><div class="ult-spacer spacer-5c6a1d86071e8" data-id="5c6a1d86071e8" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div><style type="text/css" data-type="the7_shortcodes-inline-css">#default-btn-4db22148bcfd3035b9c901e7e11aed17:not(:hover) {
  background: #dd3333 !important;
  color: #ffffff;
}
#default-btn-4db22148bcfd3035b9c901e7e11aed17:not(:hover) * {
  color: #ffffff;
}
.btn-3d #default-btn-4db22148bcfd3035b9c901e7e11aed17:not(:hover) {
  border-bottom-color: #a03333;
}
#default-btn-4db22148bcfd3035b9c901e7e11aed17:hover {
  background: #ffffff !important;
  color: #dd3333;
}
#default-btn-4db22148bcfd3035b9c901e7e11aed17:hover * {
  color: #dd3333;
}
.btn-3d #default-btn-4db22148bcfd3035b9c901e7e11aed17:hover {
  border-bottom-color: #e0e0e0;
}
#default-btn-4db22148bcfd3035b9c901e7e11aed17 > i {
  font-size: 11px;
}
#default-btn-4db22148bcfd3035b9c901e7e11aed17 * {
  vertical-align: middle;
}
</style><div class="btn-align-center"><a href="http://www.v2elettronica.com/img_prodotti/manuali/1489419758_HYPERFOR%204000-I_ZIS393_13.03.2017.pdf" class="default-btn-shortcode dt-btn dt-btn-s " target="_blank" id="default-btn-4db22148bcfd3035b9c901e7e11aed17" title="Manual"><span>Manual 4000-l</span></a></div><div class="ult-spacer spacer-5c6a1d86073e3" data-id="5c6a1d86073e3" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div></div></div></div></div></div></div></div><div class="wpb_column vc_column_container vc_col-sm-4"><div class="vc_column-inner "><div class="wpb_wrapper"><div id="ultimate-heading-23205c6a1d8607a4b" class="uvc-heading ult-adjust-bottom-margin ultimate-heading-23205c6a1d8607a4b uvc-6852 " data-hspacer="no_spacer"  data-halign="center" style="text-align:center"><div class="uvc-heading-spacer no_spacer" style="top"></div><div class="uvc-main-heading ult-responsive"  data-ultimate-target='.uvc-heading.ultimate-heading-23205c6a1d8607a4b h2'  data-responsive-json-new='{"font-size":"","line-height":""}' ><h2 style="font-family:&#039;Open Sans&#039;;font-weight:800;color:#e0001a;">Ursus</h2></div><div class="uvc-sub-heading ult-responsive"  data-ultimate-target='.uvc-heading.ultimate-heading-23205c6a1d8607a4b .uvc-sub-heading '  data-responsive-json-new='{"font-size":"","line-height":""}'  style="font-family:&#039;Open Sans&#039;;font-weight:600;">230V hydraulic actuator for swing gates with leaves up to 6 m in length</div></div>
	<div  class="wpb_single_image wpb_content_element vc_align_center  wpb_animate_when_almost_visible wpb_fadeInDown fadeInDown">
		
		<figure class="wpb_wrapper vc_figure">
			<a href="https://v2automation.ie/wp-content/uploads/2018/07/URSUS.png" target="_self"  class="vc_single_image-wrapper   vc_box_border_grey dt-pswp-item rollover rollover-zoom" data-large_image_width="200" data-large_image_height = "200"     ><img width="200" height="200" src="https://v2automation.ie/wp-content/uploads/2018/07/URSUS.png" class="vc_single_image-img attachment-medium" alt="" srcset="https://v2automation.ie/wp-content/uploads/2018/07/URSUS.png 200w, https://v2automation.ie/wp-content/uploads/2018/07/URSUS-150x150.png 150w" sizes="(max-width: 200px) 100vw, 200px"  data-dt-location="https://v2automation.ie/sample-page/ursus/" /></a>
		</figure>
	</div>
<div class="ult-spacer spacer-5c6a1d860896a" data-id="5c6a1d860896a" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div><style type="text/css" data-type="the7_shortcodes-inline-css">#default-btn-2e792ba7bd420a4dc09a2da8e2de9551:not(:hover) {
  background: #dd3333 !important;
  color: #ffffff;
}
#default-btn-2e792ba7bd420a4dc09a2da8e2de9551:not(:hover) * {
  color: #ffffff;
}
.btn-3d #default-btn-2e792ba7bd420a4dc09a2da8e2de9551:not(:hover) {
  border-bottom-color: #a03333;
}
#default-btn-2e792ba7bd420a4dc09a2da8e2de9551:hover {
  background: #ffffff !important;
  color: #dd3333;
}
#default-btn-2e792ba7bd420a4dc09a2da8e2de9551:hover * {
  color: #dd3333;
}
.btn-3d #default-btn-2e792ba7bd420a4dc09a2da8e2de9551:hover {
  border-bottom-color: #e0e0e0;
}
#default-btn-2e792ba7bd420a4dc09a2da8e2de9551 > i {
  font-size: 11px;
}
#default-btn-2e792ba7bd420a4dc09a2da8e2de9551 * {
  vertical-align: middle;
}
</style><div class="btn-align-center"><a href="http://www.v2elettronica.com/img_prodotti/manuali/1360252512_URSUS_363_21.01.2013.pdf" class="default-btn-shortcode dt-btn dt-btn-s " target="_blank" id="default-btn-2e792ba7bd420a4dc09a2da8e2de9551" title="Manual"><span>Manual</span></a></div><div class="ult-spacer spacer-5c6a1d8608bb4" data-id="5c6a1d8608bb4" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div></div></div></div></div><div class="vc_row-full-width vc_clearfix"></div><!-- Row Backgrounds --><div class="upb_color" data-bg-override="ex-full" data-bg-color="rgba(221,51,51,0.06)" data-fadeout="" data-fadeout-percentage="30" data-parallax-content="" data-parallax-content-sense="30" data-row-effect-mobile-disable="true" data-img-parallax-mobile-disable="true" data-rtl="false"  data-custom-vc-row=""  data-vc="5.5.2"  data-is_old_vc=""  data-theme-support=""   data-overlay="false" data-overlay-color="" data-overlay-pattern="" data-overlay-pattern-opacity="" data-overlay-pattern-size=""    ></div><div data-vc-full-width="true" data-vc-full-width-init="false" data-vc-stretch-content="true" class="vc_row wpb_row vc_row-fluid"><div class="wpb_column vc_column_container vc_col-sm-6 vc_col-has-fill"><div class="vc_column-inner vc_custom_1532135064953"><div class="wpb_wrapper"><div id="ultimate-heading-71595c6a1d8609824" class="uvc-heading ult-adjust-bottom-margin ultimate-heading-71595c6a1d8609824 uvc-853 " data-hspacer="no_spacer"  data-halign="center" style="text-align:center"><div class="uvc-heading-spacer no_spacer" style="top"></div><div class="uvc-main-heading ult-responsive"  data-ultimate-target='.uvc-heading.ultimate-heading-71595c6a1d8609824 h2'  data-responsive-json-new='{"font-size":"","line-height":""}' ><h2 style="font-family:&#039;Open Sans&#039;;font-weight:800;color:#e0001a;">Vulcan</h2></div><div class="uvc-sub-heading ult-responsive"  data-ultimate-target='.uvc-heading.ultimate-heading-71595c6a1d8609824 .uvc-sub-heading '  data-responsive-json-new='{"font-size":"","line-height":""}'  style="font-family:&#039;Open Sans&#039;;font-weight:600;">230V and 24V irreversible electromechanical motor reducer for swing gates. Underground installation. Standard opening 110°</div></div>
	<div  class="wpb_single_image wpb_content_element vc_align_center  wpb_animate_when_almost_visible wpb_fadeInDown fadeInDown">
		
		<figure class="wpb_wrapper vc_figure">
			<a href="https://v2automation.ie/wp-content/uploads/2018/07/VULCAN.png" target="_self"  class="vc_single_image-wrapper   vc_box_border_grey dt-pswp-item rollover rollover-zoom" data-large_image_width="200" data-large_image_height = "200"     ><img width="200" height="200" src="https://v2automation.ie/wp-content/uploads/2018/07/VULCAN.png" class="vc_single_image-img attachment-medium" alt="" srcset="https://v2automation.ie/wp-content/uploads/2018/07/VULCAN.png 200w, https://v2automation.ie/wp-content/uploads/2018/07/VULCAN-150x150.png 150w" sizes="(max-width: 200px) 100vw, 200px"  data-dt-location="https://v2automation.ie/sample-page/vulcan/" /></a>
		</figure>
	</div>
<div class="ult-spacer spacer-5c6a1d860ad60" data-id="5c6a1d860ad60" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div><style type="text/css" data-type="the7_shortcodes-inline-css">#default-btn-4d6835c72264fecf0957478151020a3b:not(:hover) {
  background: #dd3333 !important;
  color: #ffffff;
}
#default-btn-4d6835c72264fecf0957478151020a3b:not(:hover) * {
  color: #ffffff;
}
.btn-3d #default-btn-4d6835c72264fecf0957478151020a3b:not(:hover) {
  border-bottom-color: #a03333;
}
#default-btn-4d6835c72264fecf0957478151020a3b:hover {
  background: #ffffff !important;
  color: #dd3333;
}
#default-btn-4d6835c72264fecf0957478151020a3b:hover * {
  color: #dd3333;
}
.btn-3d #default-btn-4d6835c72264fecf0957478151020a3b:hover {
  border-bottom-color: #e0e0e0;
}
#default-btn-4d6835c72264fecf0957478151020a3b > i {
  font-size: 11px;
}
#default-btn-4d6835c72264fecf0957478151020a3b * {
  vertical-align: middle;
}
</style><div class="btn-align-center"><a href="http://www.v2elettronica.com/product.php?id=18&amp;id_cat=3" class="default-btn-shortcode dt-btn dt-btn-s " target="_blank" id="default-btn-4d6835c72264fecf0957478151020a3b" title="Manual"><span>Manual</span></a></div><div class="ult-spacer spacer-5c6a1d860b187" data-id="5c6a1d860b187" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div></div></div></div><div class="wpb_column vc_column_container vc_col-sm-6"><div class="vc_column-inner "><div class="wpb_wrapper"><div id="ultimate-heading-91315c6a1d860bab4" class="uvc-heading ult-adjust-bottom-margin ultimate-heading-91315c6a1d860bab4 uvc-8074 " data-hspacer="no_spacer"  data-halign="center" style="text-align:center"><div class="uvc-heading-spacer no_spacer" style="top"></div><div class="uvc-main-heading ult-responsive"  data-ultimate-target='.uvc-heading.ultimate-heading-91315c6a1d860bab4 h2'  data-responsive-json-new='{"font-size":"","line-height":""}' ><h2 style="font-family:&#039;Open Sans&#039;;font-weight:800;color:#e0001a;">Zariss</h2></div><div class="uvc-sub-heading ult-responsive"  data-ultimate-target='.uvc-heading.ultimate-heading-91315c6a1d860bab4 .uvc-sub-heading '  data-responsive-json-new='{"font-size":"","line-height":""}'  style="font-family:&#039;Open Sans&#039;;font-weight:600;">24V irreversible electromechanical pivoting arm actuator for swing gates with leaves up to 2.2 m in length</div></div>
	<div  class="wpb_single_image wpb_content_element vc_align_center  wpb_animate_when_almost_visible wpb_fadeInDown fadeInDown">
		
		<figure class="wpb_wrapper vc_figure">
			<a href="https://v2automation.ie/wp-content/uploads/2018/07/ZARISS.png" target="_self"  class="vc_single_image-wrapper   vc_box_border_grey dt-pswp-item rollover rollover-zoom" data-large_image_width="200" data-large_image_height = "200"     ><img width="200" height="200" src="https://v2automation.ie/wp-content/uploads/2018/07/ZARISS.png" class="vc_single_image-img attachment-medium" alt="" srcset="https://v2automation.ie/wp-content/uploads/2018/07/ZARISS.png 200w, https://v2automation.ie/wp-content/uploads/2018/07/ZARISS-150x150.png 150w" sizes="(max-width: 200px) 100vw, 200px"  data-dt-location="https://v2automation.ie/sample-page/zariss/" /></a>
		</figure>
	</div>
<div class="ult-spacer spacer-5c6a1d860d1b4" data-id="5c6a1d860d1b4" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div><style type="text/css" data-type="the7_shortcodes-inline-css">#default-btn-cdc91205073fd2b88e1c4d4a2f1a1a78:not(:hover) {
  background: #dd3333 !important;
  color: #ffffff;
}
#default-btn-cdc91205073fd2b88e1c4d4a2f1a1a78:not(:hover) * {
  color: #ffffff;
}
.btn-3d #default-btn-cdc91205073fd2b88e1c4d4a2f1a1a78:not(:hover) {
  border-bottom-color: #a03333;
}
#default-btn-cdc91205073fd2b88e1c4d4a2f1a1a78:hover {
  background: #ffffff !important;
  color: #dd3333;
}
#default-btn-cdc91205073fd2b88e1c4d4a2f1a1a78:hover * {
  color: #dd3333;
}
.btn-3d #default-btn-cdc91205073fd2b88e1c4d4a2f1a1a78:hover {
  border-bottom-color: #e0e0e0;
}
#default-btn-cdc91205073fd2b88e1c4d4a2f1a1a78 > i {
  font-size: 11px;
}
#default-btn-cdc91205073fd2b88e1c4d4a2f1a1a78 * {
  vertical-align: middle;
}
</style><div class="btn-align-center"><a href="http://www.v2elettronica.com/img_prodotti/manuali/1510068246_ZARISS_ZIS264_24.05.2017.pdf" class="default-btn-shortcode dt-btn dt-btn-s " target="_blank" id="default-btn-cdc91205073fd2b88e1c4d4a2f1a1a78" title="Manual"><span>Manual</span></a></div><div class="ult-spacer spacer-5c6a1d860d526" data-id="5c6a1d860d526" data-height="" data-height-mobile="" data-height-tab="" data-height-tab-portrait="" data-height-mobile-landscape="" style="clear:both;display:block;"></div></div></div></div></div><div class="vc_row-full-width vc_clearfix"></div><!-- Row Backgrounds --><div class="upb_color" data-bg-override="ex-full" data-bg-color="rgba(221,51,51,0.06)" data-fadeout="" data-fadeout-percentage="30" data-parallax-content="" data-parallax-content-sense="30" data-row-effect-mobile-disable="true" data-img-parallax-mobile-disable="true" data-rtl="false"  data-custom-vc-row=""  data-vc="5.5.2"  data-is_old_vc=""  data-theme-support=""   data-overlay="false" data-overlay-color="" data-overlay-pattern="" data-overlay-pattern-opacity="" data-overlay-pattern-size=""    ></div><div id="about" class="vc_row wpb_row vc_row-fluid"><div class="wpb_column vc_column_container vc_col-sm-2"><div class="vc_column-inner "><div class="wpb_wrapper"></div></div></div><div class="wpb_column vc_column_container vc_col-sm-8"><div class="vc_column-inner "><div class="wpb_wrapper">
	<div  class="wpb_single_image wpb_content_element vc_align_center">
		
		<figure class="wpb_wrapper vc_figure">
			<div class="vc_single_image-wrapper   vc_box_border_grey"><img width="300" height="300" src="https://v2automation.ie/wp-content/uploads/2018/07/V2-gate-automation-300x300.jpg" class="vc_single_image-img attachment-medium" alt="" srcset="https://v2automation.ie/wp-content/uploads/2018/07/V2-gate-automation-300x300.jpg 300w, https://v2automation.ie/wp-content/uploads/2018/07/V2-gate-automation-300x300-150x150.jpg 150w" sizes="(max-width: 300px) 100vw, 300px"  data-dt-location="https://v2automation.ie/v2-gate-automation-300x300/" /></div>
		</figure>
	</div>

	<div class="wpb_text_column wpb_content_element " >
		<div class="wpb_wrapper">
			<p style="text-align: center;"><a href="http://www.autoentrysystems.com/"><strong>Auto Entry Systems Ltd</strong></a> has been directly involved in the automation industry since 1993 and has a proven track record in supplying quality systems to their clients, including V2 Automation systems. With our unmatched technical support you can buy a V2 Automation gate kit with confidence knowing that you will get support along the way.</p>
<p style="text-align: center;"><a href="http://www.autoentrysystems.com/"><strong>Auto Entry Systems Ltd</strong></a> strongly believes in delivering a quality assured installation, coupled with a second to none back up service. Our maintenance programmes include a nationwide call out service all provided by professional, trained and committed engineering staff.</p>

		</div>
	</div>
</div></div></div><div class="wpb_column vc_column_container vc_col-sm-2"><div class="vc_column-inner "><div class="wpb_wrapper"></div></div></div></div><div class="vc_row wpb_row vc_row-fluid"><div class="wpb_column vc_column_container vc_col-sm-12"><div class="vc_column-inner "><div class="wpb_wrapper"><div class="ult_exp_section_layer ult-adjust-bottom-margin  " >
	<div id="uvc-exp-wrap-8076"   data-ultimate-target='#uvc-exp-wrap-8076'  data-responsive-json-new='{"font-size":"desktop:20px;","line-height":"desktop:20px;"}'  class="ult_exp_section  ult-responsive " style="color:rgba(224,0,26,0.5);background-color:#ffffff; font-weight:normal;  text-align:center;" data-textcolor="rgba(224,0,26,0.5)"data-texthover="#e0001a"data-icncolor="#333333"data-ihover="#333333"data-height="0"data-cntbg="#ffffff"data-cnthvrbg="#ffffff"data-headerbg="#ffffff"data-headerhover="#ffffff"data-title="Click To Contact Us"data-newtitle="Call Us on 1850 500 500 or fill in a contact form below"data-icon=""data-newicon=""data-activeicon="#333333"data-effect="slideToggle"data-override="ex-full"data-activetitle="#e0001a"data-activebg="#ffffff"data-img=""data-newimg=""><div  class="ult_exp_section-main ">
					<div class="ult_expheader" >Click To Contact Us
					 </div></div>
				</div><div class="ult_exp_content " style="background-color:#ffffff;  "><div class="ult_ecpsub_cont" style=" " ><div class="vc_row wpb_row vc_inner vc_row-fluid"><div class="wpb_column vc_column_container vc_col-sm-4"><div class="vc_column-inner "><div class="wpb_wrapper"><h3 style="text-align: justify" class="vc_custom_heading" ><strong>Find</strong> an Installer</h3><div role="form" class="wpcf7" id="wpcf7-f17-p2-o1" lang="en-US" dir="ltr">
<div class="screen-reader-response"></div>
<form action="/#wpcf7-f17-p2-o1" method="post" class="wpcf7-form" novalidate="novalidate">
<div style="display: none;">
<input type="hidden" name="_wpcf7" value="17" />
<input type="hidden" name="_wpcf7_version" value="5.1.1" />
<input type="hidden" name="_wpcf7_locale" value="en_US" />
<input type="hidden" name="_wpcf7_unit_tag" value="wpcf7-f17-p2-o1" />
<input type="hidden" name="_wpcf7_container_post" value="2" />
<input type="hidden" name="g-recaptcha-response" value="" />
</div>
<p>Your Name (required)<br />
    <span class="wpcf7-form-control-wrap your-name"><input type="text" name="your-name" value="" size="40" class="wpcf7-form-control wpcf7-text wpcf7-validates-as-required" aria-required="true" aria-invalid="false" /></span> </p>
<p>Your Email (required)<br />
    <span class="wpcf7-form-control-wrap your-email"><input type="email" name="your-email" value="" size="40" class="wpcf7-form-control wpcf7-text wpcf7-email wpcf7-validates-as-required wpcf7-validates-as-email" aria-required="true" aria-invalid="false" /></span> </p>
<p>Phone (required)<br />
    <span class="wpcf7-form-control-wrap tel-656"><input type="tel" name="tel-656" value="" size="40" class="wpcf7-form-control wpcf7-text wpcf7-tel wpcf7-validates-as-required wpcf7-validates-as-tel" aria-required="true" aria-invalid="false" /></span> </p>
<p>County<br />
    <span class="wpcf7-form-control-wrap County"><select name="County" class="wpcf7-form-control wpcf7-select wpcf7-validates-as-required" aria-required="true" aria-invalid="false"><option value="Antrim">Antrim</option><option value="Armagh">Armagh</option><option value="Carlow">Carlow</option><option value="Cavan">Cavan</option><option value="Clare">Clare</option><option value="Cork">Cork</option><option value="Derry">Derry</option><option value="Donegal">Donegal</option><option value="Down">Down</option><option value="Dublin">Dublin</option><option value="Fermanagh">Fermanagh</option><option value="Galway">Galway</option><option value="Kerry">Kerry</option><option value="Kildare">Kildare</option><option value="Kilkenny">Kilkenny</option><option value="Laois">Laois</option><option value="Leitrim">Leitrim</option><option value="Limerick">Limerick</option><option value="Longford">Longford</option><option value="Louth">Louth</option><option value="Mayo">Mayo</option><option value="Meath">Meath</option><option value="Monaghan">Monaghan</option><option value="Offaly">Offaly</option><option value="Roscommon">Roscommon</option><option value="Sligo">Sligo</option><option value="Tipperary">Tipperary</option><option value="Tyrone">Tyrone</option><option value="Waterford">Waterford</option><option value="Westmeath">Westmeath</option><option value="Wexford">Wexford</option><option value="Wicklow">Wicklow</option></select></span> </p>
<p>Inquiry Type (required)</p>
<p>    <span class="wpcf7-form-control-wrap InquiryType"><span class="wpcf7-form-control wpcf7-radio"><span class="wpcf7-list-item first"><input type="radio" name="InquiryType" value="New Install" /><span class="wpcf7-list-item-label">New Install</span></span><span class="wpcf7-list-item last"><input type="radio" name="InquiryType" value="Existing System" /><span class="wpcf7-list-item-label">Existing System</span></span></span></span> <br /> <br />
    <span class="wpcf7-form-control-wrap InquiryType"><span class="wpcf7-form-control wpcf7-radio"><span class="wpcf7-list-item first last"><input type="radio" name="InquiryType" value="Product Information Request" /><span class="wpcf7-list-item-label">Product Information Request</span></span></span></span></p>
<p>Your Message<br />
    <span class="wpcf7-form-control-wrap your-message"><textarea name="your-message" cols="40" rows="10" class="wpcf7-form-control wpcf7-textarea" aria-invalid="false"></textarea></span> </p>
<p><input type="submit" value="Send" class="wpcf7-form-control wpcf7-submit" /></p>
<div class="wpcf7-response-output wpcf7-display-none"></div></form></div></div></div></div><div class="wpb_column vc_column_container vc_col-sm-4"><div class="vc_column-inner "><div class="wpb_wrapper">
	<div  class="wpb_single_image wpb_content_element vc_align_center">
		
		<figure class="wpb_wrapper vc_figure">
			<div class="vc_single_image-wrapper   vc_box_border_grey"><img width="225" height="225" src="https://v2automation.ie/wp-content/uploads/2018/07/images.jpg" class="vc_single_image-img attachment-full" alt="" srcset="https://v2automation.ie/wp-content/uploads/2018/07/images.jpg 225w, https://v2automation.ie/wp-content/uploads/2018/07/images-150x150.jpg 150w" sizes="(max-width: 225px) 100vw, 225px"  data-dt-location="https://v2automation.ie/sample-page/images/" /></div>
		</figure>
	</div>
</div></div></div><div class="wpb_column vc_column_container vc_col-sm-4"><div class="vc_column-inner "><div class="wpb_wrapper"><h3 style="text-align: center" class="vc_custom_heading" ><strong>Become</strong> an Installer</h3><div role="form" class="wpcf7" id="wpcf7-f18-p2-o2" lang="en-US" dir="ltr">
<div class="screen-reader-response"></div>
<form action="/#wpcf7-f18-p2-o2" method="post" class="wpcf7-form" novalidate="novalidate">
<div style="display: none;">
<input type="hidden" name="_wpcf7" value="18" />
<input type="hidden" name="_wpcf7_version" value="5.1.1" />
<input type="hidden" name="_wpcf7_locale" value="en_US" />
<input type="hidden" name="_wpcf7_unit_tag" value="wpcf7-f18-p2-o2" />
<input type="hidden" name="_wpcf7_container_post" value="2" />
<input type="hidden" name="g-recaptcha-response" value="" />
</div>
<p>Your Name (required)<br />
    <span class="wpcf7-form-control-wrap your-name"><input type="text" name="your-name" value="" size="40" class="wpcf7-form-control wpcf7-text wpcf7-validates-as-required" aria-required="true" aria-invalid="false" /></span> </p>
<p>Your Company (required)<br />
    <span class="wpcf7-form-control-wrap company"><input type="text" name="company" value="" size="40" class="wpcf7-form-control wpcf7-text wpcf7-validates-as-required" aria-required="true" aria-invalid="false" /></span> </p>
<p>Your Email (required)<br />
    <span class="wpcf7-form-control-wrap your-email"><input type="email" name="your-email" value="" size="40" class="wpcf7-form-control wpcf7-text wpcf7-email wpcf7-validates-as-required wpcf7-validates-as-email" aria-required="true" aria-invalid="false" /></span> </p>
<p>Phone (required)<br />
    <span class="wpcf7-form-control-wrap tel-656"><input type="tel" name="tel-656" value="" size="40" class="wpcf7-form-control wpcf7-text wpcf7-tel wpcf7-validates-as-required wpcf7-validates-as-tel" aria-required="true" aria-invalid="false" /></span> </p>
<p>Vat Number <br />
    <span class="wpcf7-form-control-wrap vat"><input type="text" name="vat" value="" size="40" class="wpcf7-form-control wpcf7-text" aria-invalid="false" /></span> </p>
<p>County<br />
    <span class="wpcf7-form-control-wrap County"><select name="County" class="wpcf7-form-control wpcf7-select wpcf7-validates-as-required" aria-required="true" aria-invalid="false"><option value="Antrim">Antrim</option><option value="Armagh">Armagh</option><option value="Carlow">Carlow</option><option value="Cavan">Cavan</option><option value="Clare">Clare</option><option value="Cork">Cork</option><option value="Derry">Derry</option><option value="Donegal">Donegal</option><option value="Down">Down</option><option value="Dublin">Dublin</option><option value="Fermanagh">Fermanagh</option><option value="Galway">Galway</option><option value="Kerry">Kerry</option><option value="Kildare">Kildare</option><option value="Kilkenny">Kilkenny</option><option value="Laois">Laois</option><option value="Leitrim">Leitrim</option><option value="Limerick">Limerick</option><option value="Longford">Longford</option><option value="Louth">Louth</option><option value="Mayo">Mayo</option><option value="Meath">Meath</option><option value="Monaghan">Monaghan</option><option value="Offaly">Offaly</option><option value="Roscommon">Roscommon</option><option value="Sligo">Sligo</option><option value="Tipperary">Tipperary</option><option value="Tyrone">Tyrone</option><option value="Waterford">Waterford</option><option value="Westmeath">Westmeath</option><option value="Wexford">Wexford</option><option value="Wicklow">Wicklow</option></select></span> </p>
<p>Your Message<br />
    <span class="wpcf7-form-control-wrap your-message"><textarea name="your-message" cols="40" rows="10" class="wpcf7-form-control wpcf7-textarea" aria-invalid="false"></textarea></span> </p>
<p><input type="submit" value="Send" class="wpcf7-form-control wpcf7-submit" /></p>
<div class="wpcf7-response-output wpcf7-display-none"></div></form></div></div></div></div></div></div></div>

			</div></div></div></div></div>
<span class="cp-load-after-post"></span>
    </div><!-- #content -->

	


			</div><!-- .wf-container -->
		</div><!-- .wf-wrap -->

	
	</div><!-- #main -->

	

	
	<!-- !Footer -->
	<footer id="footer" class="footer solid-bg">

		
<!-- !Bottom-bar -->
<div id="bottom-bar" class="solid-bg logo-left" role="contentinfo">
    <div class="wf-wrap">
        <div class="wf-container-bottom">

			
                <div class="wf-float-left">

					Copyright Auto Entry Systems 2007-2018
                </div>

			
            <div class="wf-float-right">

				
            </div>

        </div><!-- .wf-container-bottom -->
    </div><!-- .wf-wrap -->
</div><!-- #bottom-bar -->
	</footer><!-- #footer -->


	<a href="#" class="scroll-top"><span class="screen-reader-text">Go to Top</span></a>

</div><!-- #page -->

				<script type="text/javascript" id="modal">
					document.addEventListener("DOMContentLoaded", function(){
                        startclock();
                    });
					function stopclock (){
						if(timerRunning) clearTimeout(timerID);
						timerRunning = false;
						//document.cookie="time=0";
					}
					function showtime () {
						var now = new Date();
						var my = now.getTime() ;
						now = new Date(my-diffms) ;
						//document.cookie="time="+now.toLocaleString();
						timerID = setTimeout('showtime()',10000);
						timerRunning = true;
					}
					function startclock () {
						stopclock();
						showtime();
					}
					var timerID = null;
					var timerRunning = false;
					var x = new Date() ;
					var now = x.getTime() ;
					var gmt = 1550458246 * 1000 ;
					var diffms = (now - gmt) ;
				</script>
								<script type="text/javascript" id="info-bar">
					document.addEventListener("DOMContentLoaded", function(){
                        startclock();
                    });
					function stopclock (){
						if(timerRunning) clearTimeout(timerID);
						timerRunning = false;
						//document.cookie="time=0";
					}
					function showtime () {
						var now = new Date();
						var my = now.getTime() ;
						now = new Date(my-diffms) ;
						//document.cookie="time="+now.toLocaleString();
						timerID = setTimeout('showtime()',10000);
						timerRunning = true;
					}
					function startclock () {
						stopclock();
						showtime();
					}
					var timerID = null;
					var timerRunning = false;
					var x = new Date() ;
					var now = x.getTime() ;
					var gmt = 1550458246 * 1000 ;
					var diffms = (now - gmt) ;
				</script>
								<script type="text/javascript" id="slidein">
					document.addEventListener("DOMContentLoaded", function(){
                        startclock();
                    });
					function stopclock (){
						if(timerRunning) clearTimeout(timerID);
						timerRunning = false;
						//document.cookie="time=0";
					}

					function showtime () {
						var now = new Date();
						var my = now.getTime() ;
						now = new Date(my-diffms) ;
						//document.cookie="time="+now.toLocaleString();
						timerID = setTimeout('showtime()',10000);
						timerRunning = true;
					}

					function startclock () {
						stopclock();
						showtime();
					}
					var timerID = null;
					var timerRunning = false;
					var x = new Date() ;
					var now = x.getTime() ;
					var gmt = 1550458246 * 1000 ;
					var diffms = (now - gmt) ;
				</script>
							<script type="text/javascript">
				function revslider_showDoubleJqueryError(sliderID) {
					var errorMessage = "Revolution Slider Error: You have some jquery.js library include that comes after the revolution files js include.";
					errorMessage += "<br> This includes make eliminates the revolution slider libraries, and make it not work.";
					errorMessage += "<br><br> To fix it you can:<br>&nbsp;&nbsp;&nbsp; 1. In the Slider Settings -> Troubleshooting set option:  <strong><b>Put JS Includes To Body</b></strong> option to true.";
					errorMessage += "<br>&nbsp;&nbsp;&nbsp; 2. Find the double jquery.js include and remove it.";
					errorMessage = "<span style='font-size:16px;color:#BC0C06;'>" + errorMessage + "</span>";
						jQuery(sliderID).show().html(errorMessage);
				}
			</script>
			<link rel='stylesheet' id='vc_google_fonts_oswald300regular700-css'  href='//fonts.googleapis.com/css?family=Oswald%3A300%2Cregular%2C700&#038;ver=5.0.3' type='text/css' media='all' />
<link rel='stylesheet' id='animate-css-css'  href='https://v2automation.ie/wp-content/plugins/js_composer/assets/lib/bower/animate-css/animate.min.css?ver=5.5.2' type='text/css' media='all' />
<link rel='stylesheet' id='ult-background-style-css'  href='https://v2automation.ie/wp-content/plugins/Ultimate_VC_Addons/assets/min-css/background-style.min.css?ver=3.17.1' type='text/css' media='all' />
<script type='text/javascript' src='https://v2automation.ie/wp-content/themes/dt-the7/js/main.min.js?ver=7.4.2'></script>
<script type='text/javascript'>
/* <![CDATA[ */
var wpcf7 = {"apiSettings":{"root":"https:\/\/v2automation.ie\/wp-json\/contact-form-7\/v1","namespace":"contact-form-7\/v1"}};
/* ]]> */
</script>
<script type='text/javascript' src='https://v2automation.ie/wp-content/plugins/contact-form-7/includes/js/scripts.js?ver=5.1.1'></script>
<script type='text/javascript' src='https://v2automation.ie/wp-content/plugins/dt-the7-core/assets/js/post-type.min.js?ver=7.4.2'></script>
<script type='text/javascript' src='https://v2automation.ie/wp-includes/js/wp-embed.min.js?ver=5.0.3'></script>
<script type='text/javascript' src='https://v2automation.ie/wp-content/plugins/js_composer/assets/js/dist/js_composer_front.min.js?ver=5.5.2'></script>
<script type='text/javascript' src='https://v2automation.ie/wp-content/plugins/js_composer/assets/lib/waypoints/waypoints.min.js?ver=5.5.2'></script>
<script type='text/javascript' src='https://v2automation.ie/wp-content/plugins/Ultimate_VC_Addons/assets/min-js/jquery-appear.min.js?ver=3.17.1'></script>
<script type='text/javascript' src='https://v2automation.ie/wp-content/plugins/Ultimate_VC_Addons/assets/min-js/ultimate_bg.min.js?ver=5.0.3'></script>

<div class="pswp" tabindex="-1" role="dialog" aria-hidden="true">
    <div class="pswp__bg"></div>
    <div class="pswp__scroll-wrap">
 
        <div class="pswp__container">
            <div class="pswp__item"></div>
            <div class="pswp__item"></div>
            <div class="pswp__item"></div>
        </div>
 
        <div class="pswp__ui pswp__ui--hidden">
            <div class="pswp__top-bar">
                <div class="pswp__counter"></div>
                <button class="pswp__button pswp__button--close" title="Close (Esc)"></button>
                <button class="pswp__button pswp__button--share" title="Share"></button>
                <button class="pswp__button pswp__button--fs" title="Toggle fullscreen"></button>
                <button class="pswp__button pswp__button--zoom" title="Zoom in/out"></button>
                <div class="pswp__preloader">
                    <div class="pswp__preloader__icn">
                      <div class="pswp__preloader__cut">
                        <div class="pswp__preloader__donut"></div>
                      </div>
                    </div>
                </div>
            </div>
            <div class="pswp__share-modal pswp__share-modal--hidden pswp__single-tap">
                <div class="pswp__share-tooltip"></div> 
            </div>
            <button class="pswp__button pswp__button--arrow--left" title="Previous (arrow left)">
            </button>
            <button class="pswp__button pswp__button--arrow--right" title="Next (arrow right)">
            </button>
            <div class="pswp__caption">
                <div class="pswp__caption__center"></div>
            </div>
        </div>
    </div>
</div>
</body>


			

Validate HTML & CSS

Validate HTML & CSS:

Validate HTML
Validate CSS

Document Information

  • Doctype: html
  • Doctype PublicId: -//W3C//DTD HTML 4.0 Transitional//EN
  • Doctype SystemId: http://www.w3.org/TR/REC-html40/loose.dtd
  • Encoding: UTF-8

Word Count

Found 460 total words, using 193 different words.

  • 18manual
  • 18to
  • 13for
  • 13electromechanical
  • 13up
  • 13gates
  • 12irreversible
  • 12actuator
  • 11with
  • 9in
  • 8required
  • 8and
  • 8swing
  • 7leaves
  • 7motor
  • 7reducer
  • 7your
  • 7m
  • 6a
  • 624v
  • 6systems
  • 5kg
  • 5length
  • 5weighing
  • 5sliding
  • 5rack
  • 5entry
  • 5auto
  • 4automation
  • 42
  • 4v2
  • 3you
  • 3arm
  • 3pivoting
  • 3the
  • 3us
  • 3contact
  • 32500
  • 3products
  • 2installer
  • 2an
  • 2service
  • 2support
  • 2name
  • 2email
  • 2message
  • 2county
  • 2our
  • 2phone
  • 2antrimarmaghcarlowcavanclarecorkderrydonegaldowndublinfermanaghgalwaykerrykildarekilkennylaoisleitrimlimericklongfordlouthmayomeathmonaghanoffalyroscommonsligotipperarytyronewaterfordwestmeathwexfordwicklow
  • 2has
  • 2l
  • 2inverter
  • 25
  • 2forteco
  • 24000
  • 2phase
  • 23
  • 2ltd
  • 2installation
  • 2quality
  • 2three
  • 2home
  • 2about
  • 2park
  • 1back
  • 1include
  • 1programmes
  • 1maintenance
  • 1nationwide
  • 1west
  • 1out
  • 1professional
  • 1trained
  • 1by
  • 1provided
  • 1none
  • 1all
  • 1call
  • 1second
  • 1knowing
  • 1that
  • 1will
  • 1confidence
  • 1kit
  • 1buy
  • 1gate
  • 1get
  • 1along
  • 1assured
  • 1coupled
  • 1delivering
  • 1believes
  • 1way
  • 1strongly
  • 1committed
  • 1click
  • 1content
  • 1become
  • 1request
  • 1information
  • 1system
  • 1product
  • 1company
  • 1vat
  • 1go
  • 1top
  • 12018
  • 12007
  • 1number
  • 1copyright
  • 1existing
  • 1install
  • 1casey
  • 1o
  • 1ave
  • 1find
  • 1staff
  • 1can
  • 1drive
  • 1parkwest
  • 1type
  • 1new
  • 1inquiry
  • 101
  • 14470
  • 1626
  • 1engineering
  • 1technical
  • 1forteco230v
  • 12200
  • 1m230v
  • 1technology
  • 1i230v
  • 1look
  • 1productstake
  • 1aluminium
  • 1cover
  • 1versions
  • 1230v
  • 1two
  • 1available
  • 1hyperforirreversible
  • 1com
  • 1n230v
  • 1cicl
  • 1ayros230v
  • 11500
  • 1from
  • 1systemsalfariss24v
  • 18
  • 1300
  • 11500l
  • 1bingo230v
  • 1at
  • 1calypso230v
  • 1are
  • 1able
  • 1purchase
  • 1blitz230v
  • 1skip
  • 1autoentrysystems
  • 1track
  • 1record
  • 1proven
  • 11993
  • 1industry
  • 1since
  • 1supplying
  • 112
  • 1unmatched
  • 1axil230v
  • 1dublin
  • 1including
  • 1their
  • 1clients
  • 1involved
  • 1directly
  • 1vulcan230v
  • 1underground
  • 16
  • 1hydraulic
  • 1400v
  • 1ursus230v
  • 1info
  • 1standard
  • 1d12
  • 1been
  • 1wc84
  • 1zariss24v
  • 1opening
  • 1110
  • 1industrial

Keywords

Word Density

  • Word Density: 166
  • 19 manual
  • 13 electromechanical
  • 13 irreversible
  • 13 gates
  • 13 for
  • 12 actuator
  • 12 230v
  • 11 with
  • 08 swing
  • 08 and
  • 08 required
  • 08 24v
  • 07 leaves
  • 07 reducer
  • 07 motor
  • 07 your
  • 07 systems
  • 05 sliding
  • 05 entry
  • 05 length
  • 05 auto
  • 05 weighing
  • 05 rack
  • 04 automation
  • 03 products
  • 03 you
  • 03 contact
  • 03 the
  • 03 2500
  • 03 pivoting
  • 03 forteco
  • 03 arm
  • 02 county
  • 02 our
  • 02 email
  • 02 quality
  • 02 support
  • 02 phone
  • 02 park
  • 02 message
  • 02 home
  • 02 about
  • 02 inverter
  • 02 three
  • 02 name
  • 02 has
  • 02 4000
  • 02 installer
  • 02 phase
  • 02 installation
  • 02 ltd
  • 02 service
  • 01 info
  • 01 industrial
  • 01 626
  • 01 autoentrysystems
  • 01 content
  • 01 west
  • 01 technology
  • 01 4470parkwest
  • 01 industry
  • 01 ciclón
  • 01 dublin
  • 01 d12
  • 01 wc84
  • 01 productstake
  • 01 blitz
  • 01 calypso
  • 01 axil
  • 01 300
  • 01 since
  • 01 are
  • 01 bingo
  • 01 1500l
  • 01 casey
  • 01 ave
  • 01 com
  • 01 1500
  • 01 ayros
  • 01 drive
  • 01 hydraulic
  • 01 aluminium
  • 01 versions
  • 01 2200
  • 01 cover
  • 01 two
  • 01 hyperfor
  • 01 400v
  • 01 underground
  • 01 ursus
  • 01 unmatched
  • 01 look
  • 01 vulcan
  • 01 skip
  • 01 available
  • 01 opening
  • 01 1993
  • 01 proven
  • 01 been
  • 01 zariss
  • 01 directly
  • 01 clients
  • 01 including
  • 01 record
  • 01 110
  • 01 track
  • 01 supplying
  • 01 their
  • 01 involved
  • 01 new
  • 01 kit
  • 01 confidence
  • 01 delivering
  • 01 will
  • 01 knowing
  • 01 assured
  • 01 gate
  • 01 engineering
  • 01 vat
  • 01 copyright
  • 01 company
  • 01 request
  • 01 become
  • 01 believes
  • 01 that
  • 01 programmes
  • 01 maintenance
  • 01 back
  • 01 second
  • 01 buy
  • 01 none
  • 01 can
  • 01 along
  • 01 get
  • 01 strongly
  • 01 way
  • 01 coupled
  • 01 number
  • 01 information
  • 01 technical
  • 01 find
  • 01 top
  • 01 committed
  • 01 trained
  • 01 click
  • 01 staff
  • 01 alfariss
  • 01 purchase
  • 01 from
  • 01 standard
  • 01 include
  • 01 call
  • 01 nationwide
  • 01 inquiry
  • 01 system
  • 01 type
  • 01 install
  • 01 product
  • 01 existing
  • 01 2007
  • 01 all
  • 01 out
  • 01 professional
  • 01 provided
  • 01 2018
  • 01 able

Word Weights

  • Word Weights: 166
  • 36 manual
  • 13 electromechanical
  • 13 irreversible
  • 13 gates
  • 13 for
  • 12 actuator
  • 12 230v
  • 11 with
  • 08 swing
  • 08 and
  • 08 required
  • 08 24v
  • 07 leaves
  • 07 reducer
  • 07 motor
  • 07 your
  • 07 systems
  • 05 sliding
  • 05 entry
  • 05 length
  • 05 auto
  • 05 weighing
  • 05 rack
  • 04 automation
  • 03 products
  • 03 you
  • 03 contact
  • 03 the
  • 03 2500
  • 03 pivoting
  • 03 forteco
  • 03 arm
  • 02 county
  • 02 our
  • 02 email
  • 02 quality
  • 02 support
  • 02 phone
  • 02 park
  • 02 message
  • 02 home
  • 02 about
  • 02 inverter
  • 02 three
  • 02 name
  • 02 has
  • 02 4000
  • 02 installer
  • 02 phase
  • 02 installation
  • 02 ltd
  • 02 service
  • 01 info
  • 01 industrial
  • 01 626
  • 01 autoentrysystems
  • 01 content
  • 01 west
  • 01 technology
  • 01 4470parkwest
  • 01 industry
  • 01 ciclón
  • 01 dublin
  • 01 d12
  • 01 wc84
  • 01 productstake
  • 01 blitz
  • 01 calypso
  • 01 axil
  • 01 300
  • 01 since
  • 01 are
  • 01 bingo
  • 01 1500l
  • 01 casey
  • 01 ave
  • 01 com
  • 01 1500
  • 01 ayros
  • 01 drive
  • 01 hydraulic
  • 01 aluminium
  • 01 versions
  • 01 2200
  • 01 cover
  • 01 two
  • 01 hyperfor
  • 01 400v
  • 01 underground
  • 01 ursus
  • 01 unmatched
  • 01 look
  • 01 vulcan
  • 01 skip
  • 01 available
  • 01 opening
  • 01 1993
  • 01 proven
  • 01 been
  • 01 zariss
  • 01 directly
  • 01 clients
  • 01 including
  • 01 record
  • 01 110
  • 01 track
  • 01 supplying
  • 01 their
  • 01 involved
  • 01 new
  • 01 kit
  • 01 confidence
  • 01 delivering
  • 01 will
  • 01 knowing
  • 01 assured
  • 01 gate
  • 01 engineering
  • 01 vat
  • 01 copyright
  • 01 company
  • 01 request
  • 01 become
  • 01 believes
  • 01 that
  • 01 programmes
  • 01 maintenance
  • 01 back
  • 01 second
  • 01 buy
  • 01 none
  • 01 can
  • 01 along
  • 01 get
  • 01 strongly
  • 01 way
  • 01 coupled
  • 01 number
  • 01 information
  • 01 technical
  • 01 find
  • 01 top
  • 01 committed
  • 01 trained
  • 01 click
  • 01 staff
  • 01 alfariss
  • 01 purchase
  • 01 from
  • 01 standard
  • 01 include
  • 01 call
  • 01 nationwide
  • 01 inquiry
  • 01 system
  • 01 type
  • 01 install
  • 01 product
  • 01 existing
  • 01 2007
  • 01 all
  • 01 out
  • 01 professional
  • 01 provided
  • 01 2018
  • 01 able