talentpoolltd.ie Details

Select the tabs below for more information

Share This
Share On Facebook Share On Twitter Share On Google Share On LinkedIn Pinterest Email



talentpoolltd.ie Domain Thumbnail

talentpoolltd.ie

talentpoolltd.ie

www.talentpoolltd.ie

Social Media Link Popularity

Ads By Google

Server Information

SEO Title & Meta Tags

Title: Home - Talentpool Ltd

Summary

Skip to content About Us Women In Leadership Programmes Brexit Data Protection Managing People Mediation Retail Management Training and Development Our Work Tel: 045 864727 Contact    Training - Mentoring - Coaching Helping others see a world of dreams! 1 TRAINING Talentpool is a QQI registered training provider.   We issue qualifications on the National Framework of Qualifications. Talentpool directors and trainers have a long history of developing and delivering programmes at QQI levels from level 3 to level 6.  Our consultancy division designs and completes programmes descriptors on a commercial basis. Talentpool works across the country providing business training, mentoring and coaching

Domain and IP Whois Lookup Tool

Lookup Domain and IP Ownership Records:

Whois Information

DNS Information

Lookup DNS Records:

NS (Name Server) records are:

  • ns4.blacknight.com
  • ns1.blacknight.com
  • ns2.blacknight.com
  • ns3.blacknight.com

MX (Mail Exchanger) records are:

  • smtp1r.cp.blacknight.com

A records are:

  • host: talentpoolltd.ie
  • class: IN
  • ttl: 3599
  • type: A
  • ip: 78.153.220.139
DNS Information

HTML Source

HTML Head Source:

			<html lang="en-GB" prefix="og: http://ogp.me/ns#">
<head>
<meta charset="UTF-8">
<meta name="viewport" content="width=device-width, initial-scale=1">
<link rel="profile" href="https://gmpg.org/xfn/11">
<link rel="pingback" href="https://talentpoolltd.ie/xmlrpc.php">








<title>Home - Talentpool Ltd</title>
<script>window._wca = window._wca || [];</script>

<!-- This site is optimized with the Yoast SEO Premium plugin v11.0 - https://yoast.com/wordpress/plugins/seo/ -->
<link rel="canonical" href="https://talentpoolltd.ie/" />
<meta property="og:locale" content="en_GB" />
<meta property="og:type" content="website" />
<meta property="og:title" content="Home - Talentpool Ltd" />
<meta property="og:description" content="Talentpool is a QQI registered training provider.   We issue qualifications on the National Framework of Qualifications. Talentpool directors and trainers have a long history of developing and delivering programmes at QQI levels from level 3 to level 6.  Our consultancy division designs and completes programmes descriptors on a commercial basis. Talentpool works across the country providing &hellip;" />
<meta property="og:url" content="https://talentpoolltd.ie/" />
<meta property="og:site_name" content="Talentpool Ltd" />
<meta property="fb:app_id" content="https://www.facebook.com/talentpoolltd/" />
<meta name="twitter:card" content="summary_large_image" />
<meta name="twitter:description" content="Talentpool is a QQI registered training provider.   We issue qualifications on the National Framework of Qualifications. Talentpool directors and trainers have a long history of developing and delivering programmes at QQI levels from level 3 to level 6.  Our consultancy division designs and completes programmes descriptors on a commercial basis. Talentpool works across the country providing [&hellip;]" />
<meta name="twitter:title" content="Home - Talentpool Ltd" />
<meta name="twitter:site" content="@bisiseasy" />
<meta name="twitter:image" content="https://talentpoolltd.ie/wp-content/uploads/2018/01/qq-award-logo-300x173.png" />
<meta name="twitter:creator" content="@bisiseasy" />
<script type='application/ld+json' class='yoast-schema-graph yoast-schema-graph--main'>{"@context":"https://schema.org","@graph":[{"@type":"Organization","@id":"https://talentpoolltd.ie/#organization","name":"Talentpool Ltd","url":"https://talentpoolltd.ie/","sameAs":["https://www.facebook.com/talentpoolltd/","https://www.linkedin.com/company/2393795/","https://www.youtube.com/channel/UCX6kisqX2rax9IZbEK5_u1A?view_as=subscriber","https://twitter.com/bisiseasy"],"logo":{"@type":"ImageObject","@id":"https://talentpoolltd.ie/#logo","url":"https://talentpoolltd.ie/wp-content/uploads/2018/01/talentpool_black-1.png","caption":"Talentpool Ltd"},"image":{"@id":"https://talentpoolltd.ie/#logo"}},{"@type":"WebSite","@id":"https://talentpoolltd.ie/#website","url":"https://talentpoolltd.ie/","name":"Talentpool Ltd","publisher":{"@id":"https://talentpoolltd.ie/#organization"},"potentialAction":{"@type":"SearchAction","target":"https://talentpoolltd.ie/?s={search_term_string}","query-input":"required name=search_term_string"}},{"@type":"WebPage","@id":"https://talentpoolltd.ie/#webpage","url":"https://talentpoolltd.ie/","inLanguage":"en-GB","name":"Home - Talentpool Ltd","isPartOf":{"@id":"https://talentpoolltd.ie/#website"},"about":{"@id":"https://talentpoolltd.ie/#organization"},"datePublished":"2018-01-04T11:04:22+00:00","dateModified":"2018-07-09T08:41:14+00:00"}]}</script>
<!-- / Yoast SEO Premium plugin. -->

<link rel='dns-prefetch' href='//s0.wp.com' />
<link rel='dns-prefetch' href='//secure.gravatar.com' />
<link rel='dns-prefetch' href='//fonts.googleapis.com' />
<link rel='dns-prefetch' href='//s.w.org' />
<link rel="alternate" type="application/rss+xml" title="Talentpool Ltd &raquo; Feed" href="https://talentpoolltd.ie/feed/" />
<link rel="alternate" type="application/rss+xml" title="Talentpool Ltd &raquo; Comments Feed" href="https://talentpoolltd.ie/comments/feed/" />
		<script type="text/javascript">
			window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/11\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/11\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/talentpoolltd.ie\/wp-includes\/js\/wp-emoji-release.min.js?ver=4.9.10"}};
			!function(a,b,c){function d(a,b){var c=String.fromCharCode;l.clearRect(0,0,k.width,k.height),l.fillText(c.apply(this,a),0,0);var d=k.toDataURL();l.clearRect(0,0,k.width,k.height),l.fillText(c.apply(this,b),0,0);var e=k.toDataURL();return d===e}function e(a){var b;if(!l||!l.fillText)return!1;switch(l.textBaseline="top",l.font="600 32px Arial",a){case"flag":return!(b=d([55356,56826,55356,56819],[55356,56826,8203,55356,56819]))&&(b=d([55356,57332,56128,56423,56128,56418,56128,56421,56128,56430,56128,56423,56128,56447],[55356,57332,8203,56128,56423,8203,56128,56418,8203,56128,56421,8203,56128,56430,8203,56128,56423,8203,56128,56447]),!b);case"emoji":return b=d([55358,56760,9792,65039],[55358,56760,8203,9792,65039]),!b}return!1}function f(a){var c=b.createElement("script");c.src=a,c.defer=c.type="text/javascript",b.getElementsByTagName("head")[0].appendChild(c)}var g,h,i,j,k=b.createElement("canvas"),l=k.getContext&&k.getContext("2d");for(j=Array("flag","emoji"),c.supports={everything:!0,everythingExceptFlag:!0},i=0;i<j.length;i++)c.supports[j[i]]=e(j[i]),c.supports.everything=c.supports.everything&&c.supports[j[i]],"flag"!==j[i]&&(c.supports.everythingExceptFlag=c.supports.everythingExceptFlag&&c.supports[j[i]]);c.supports.everythingExceptFlag=c.supports.everythingExceptFlag&&!c.supports.flag,c.DOMReady=!1,c.readyCallback=function(){c.DOMReady=!0},c.supports.everything||(h=function(){c.readyCallback()},b.addEventListener?(b.addEventListener("DOMContentLoaded",h,!1),a.addEventListener("load",h,!1)):(a.attachEvent("onload",h),b.attachEvent("onreadystatechange",function(){"complete"===b.readyState&&c.readyCallback()})),g=c.source||{},g.concatemoji?f(g.concatemoji):g.wpemoji&&g.twemoji&&(f(g.twemoji),f(g.wpemoji)))}(window,document,window._wpemojiSettings);
		</script>
		<style type="text/css">
img.wp-smiley,
img.emoji {
	display: inline !important;
	border: none !important;
	box-shadow: none !important;
	height: 1em !important;
	width: 1em !important;
	margin: 0 .07em !important;
	vertical-align: -0.1em !important;
	background: none !important;
	padding: 0 !important;
}
</style>
<link rel='stylesheet' id='sydney-wc-css-css'  href='https://talentpoolltd.ie/wp-content/themes/sydney/woocommerce/css/wc.css?ver=4.9.10' type='text/css' media='all' />
<link rel='stylesheet' id='sydney-bootstrap-css'  href='https://talentpoolltd.ie/wp-content/themes/sydney/css/bootstrap/bootstrap.min.css?ver=1' type='text/css' media='all' />
<link rel='stylesheet' id='siteorigin-panels-front-css'  href='https://talentpoolltd.ie/wp-content/plugins/siteorigin-panels/css/front-flex.min.css?ver=2.10.5' type='text/css' media='all' />
<link rel='stylesheet' id='sow-social-media-buttons-atom-05e2f8945e27-css'  href='https://talentpoolltd.ie/wp-content/uploads/siteorigin-widgets/sow-social-media-buttons-atom-05e2f8945e27.css?ver=4.9.10' type='text/css' media='all' />
<link rel='stylesheet' id='woocommerce-layout-css'  href='https://talentpoolltd.ie/wp-content/plugins/woocommerce/assets/css/woocommerce-layout.css?ver=3.6.1' type='text/css' media='all' />
<style id='woocommerce-layout-inline-css' type='text/css'>

	.infinite-scroll .woocommerce-pagination {
		display: none;
	}
</style>
<link rel='stylesheet' id='woocommerce-smallscreen-css'  href='https://talentpoolltd.ie/wp-content/plugins/woocommerce/assets/css/woocommerce-smallscreen.css?ver=3.6.1' type='text/css' media='only screen and (max-width: 768px)' />
<style id='woocommerce-inline-inline-css' type='text/css'>
.woocommerce form .form-row .required { visibility: visible; }
</style>
<link rel='stylesheet' id='chld_thm_cfg_parent-css'  href='https://talentpoolltd.ie/wp-content/themes/sydney/style.css?ver=4.9.10' type='text/css' media='all' />
<link rel='stylesheet' id='sydney-fonts-css'  href='https://fonts.googleapis.com/css?family=family%3DEncode+Sans+Expanded%3A300%2C400%2C500%7CEncode+Sans+Expanded%3A300%2C400%2C500' type='text/css' media='all' />
<link rel='stylesheet' id='sydney-style-css'  href='https://talentpoolltd.ie/wp-content/themes/sydney-child/style.css?ver=1.43.1516044311' type='text/css' media='all' />
<style id='sydney-style-inline-css' type='text/css'>
.site-header { background-color:rgba(255,255,255,0.9);}
body, #mainnav ul ul a { font-family:'Encode Sans Expanded', sans-serif!important;}
h1, h2, h3, h4, h5, h6, #mainnav ul li a, .portfolio-info, .roll-testimonials .name, .roll-team .team-content .name, .roll-team .team-item .team-pop .name, .roll-tabs .menu-tab li a, .roll-testimonials .name, .roll-project .project-filter li a, .roll-button, .roll-counter .name-count, .roll-counter .numb-count button, input[type="button"], input[type="reset"], input[type="submit"] { font-family:'Encode Sans Expanded', sans-serif;}
.site-title { font-size:37px; }
.site-description { font-size:20px; }
#mainnav ul li a { font-size:16px; }
h1 { font-size:52px; }
h2 { font-size:42px; }
h3 { font-size:32px; }
h4 { font-size:25px; }
h5 { font-size:20px; }
h6 { font-size:18px; }
body { font-size:16px; }
.single .hentry .title-post { font-size:36px; }
.header-image { background-size:cover;}
.header-image { height:300px; }
.widget-area .widget_fp_social a,#mainnav ul li a:hover, .sydney_contact_info_widget span, .roll-team .team-content .name,.roll-team .team-item .team-pop .team-social li:hover a,.roll-infomation li.address:before,.roll-infomation li.phone:before,.roll-infomation li.email:before,.roll-testimonials .name,.roll-button.border,.roll-button:hover,.roll-icon-list .icon i,.roll-icon-list .content h3 a:hover,.roll-icon-box.white .content h3 a,.roll-icon-box .icon i,.roll-icon-box .content h3 a:hover,.switcher-container .switcher-icon a:focus,.go-top:hover,.hentry .meta-post a:hover,#mainnav > ul > li > a.active, #mainnav > ul > li > a:hover, button:hover, input[type="button"]:hover, input[type="reset"]:hover, input[type="submit"]:hover, .text-color, .social-menu-widget a, .social-menu-widget a:hover, .archive .team-social li a, a, h1 a, h2 a, h3 a, h4 a, h5 a, h6 a,.classic-alt .meta-post a,.single .hentry .meta-post a { color:#913835}
.reply,.woocommerce div.product .woocommerce-tabs ul.tabs li.active,.woocommerce #respond input#submit,.woocommerce a.button,.woocommerce button.button,.woocommerce input.button,.project-filter li a.active, .project-filter li a:hover,.preloader .pre-bounce1, .preloader .pre-bounce2,.roll-team .team-item .team-pop,.roll-progress .progress-animate,.roll-socials li a:hover,.roll-project .project-item .project-pop,.roll-project .project-filter li.active,.roll-project .project-filter li:hover,.roll-button.light:hover,.roll-button.border:hover,.roll-button,.roll-icon-box.white .icon,.owl-theme .owl-controls .owl-page.active span,.owl-theme .owl-controls.clickable .owl-page:hover span,.go-top,.bottom .socials li:hover a,.sidebar .widget:before,.blog-pagination ul li.active,.blog-pagination ul li:hover a,.content-area .hentry:after,.text-slider .maintitle:after,.error-wrap #search-submit:hover,#mainnav .sub-menu li:hover > a,#mainnav ul li ul:after, button, input[type="button"], input[type="reset"], input[type="submit"], .panel-grid-cell .widget-title:after { background-color:#913835}
.roll-socials li a:hover,.roll-socials li a,.roll-button.light:hover,.roll-button.border,.roll-button,.roll-icon-list .icon,.roll-icon-box .icon,.owl-theme .owl-controls .owl-page span,.comment .comment-detail,.widget-tags .tag-list a:hover,.blog-pagination ul li,.hentry blockquote,.error-wrap #search-submit:hover,textarea:focus,input[type="text"]:focus,input[type="password"]:focus,input[type="datetime"]:focus,input[type="datetime-local"]:focus,input[type="date"]:focus,input[type="month"]:focus,input[type="time"]:focus,input[type="week"]:focus,input[type="number"]:focus,input[type="email"]:focus,input[type="url"]:focus,input[type="search"]:focus,input[type="tel"]:focus,input[type="color"]:focus, button, input[type="button"], input[type="reset"], input[type="submit"], .archive .team-social li a { border-color:#913835}
.site-header.float-header { background-color:rgba(255,255,255,0.9);}
@media only screen and (max-width: 1024px) { .site-header { background-color:#ffffff;}}
.site-title a, .site-title a:hover { color:#ffffff}
.site-description { color:#ffffff}
#mainnav ul li a, #mainnav ul li::before { color:#000000}
#mainnav .sub-menu li a { color:#ffffff}
#mainnav .sub-menu li a { background:#000000}
.text-slider .maintitle, .text-slider .subtitle { color:#ffffff}
body { color:#47425d}
#secondary { background-color:#ffffff}
#secondary, #secondary a, #secondary .widget-title { color:#767676}
.footer-widgets { background-color:#252525}
.btn-menu { color:#000000}
#mainnav ul li a:hover { color:#a5320e}
.site-footer { background-color:#1c1c1c}
.site-footer,.site-footer a { color:#666666}
.overlay { background-color:#000000}
.page-wrap { padding-top:83px;}
.page-wrap { padding-bottom:100px;}
.slide-inner { display:none;}
.slide-inner.text-slider-stopped { display:block;}
@media only screen and (max-width: 1025px) {		
			.mobile-slide {
				display: block;
			}
			.slide-item {
				background-image: none !important;
			}
			.header-slider {
			}
			.slide-item {
				height: auto !important;
			}
			.slide-inner {
				min-height: initial;
			} 
		}
@media only screen and (max-width: 780px) { 
    	h1 { font-size: 32px;}
		h2 { font-size: 28px;}
		h3 { font-size: 22px;}
		h4 { font-size: 18px;}
		h5 { font-size: 16px;}
		h6 { font-size: 14px;}
    }

</style>
<link rel='stylesheet' id='sydney-font-awesome-css'  href='https://talentpoolltd.ie/wp-content/themes/sydney/fonts/font-awesome.min.css?ver=4.9.10' type='text/css' media='all' />
<!--[if lte IE 9]>
<link rel='stylesheet' id='sydney-ie9-css'  href='https://talentpoolltd.ie/wp-content/themes/sydney/css/ie9.css?ver=4.9.10' type='text/css' media='all' />
<![endif]-->
<link rel='stylesheet' id='jetpack_css-css'  href='https://talentpoolltd.ie/wp-content/plugins/jetpack/css/jetpack.css?ver=7.1.1' type='text/css' media='all' />
<script>if (document.location.protocol != "https:") {document.location = document.URL.replace(/^http:/i, "https:");}</script><script type='text/javascript' src='https://talentpoolltd.ie/wp-includes/js/jquery/jquery.js?ver=1.12.4'></script>
<script type='text/javascript' src='https://talentpoolltd.ie/wp-includes/js/jquery/jquery-migrate.min.js?ver=1.4.1'></script>
<link rel='https://api.w.org/' href='https://talentpoolltd.ie/wp-json/' />
<link rel="EditURI" type="application/rsd+xml" title="RSD" href="https://talentpoolltd.ie/xmlrpc.php?rsd" />
<link rel="wlwmanifest" type="application/wlwmanifest+xml" href="https://talentpoolltd.ie/wp-includes/wlwmanifest.xml" /> 
<meta name="generator" content="WordPress 4.9.10" />
<meta name="generator" content="WooCommerce 3.6.1" />
<link rel='shortlink' href='https://wp.me/P9AtzL-4i' />
<link rel="alternate" type="application/json+oembed" href="https://talentpoolltd.ie/wp-json/oembed/1.0/embed?url=https%3A%2F%2Ftalentpoolltd.ie%2F" />
<link rel="alternate" type="text/xml+oembed" href="https://talentpoolltd.ie/wp-json/oembed/1.0/embed?url=https%3A%2F%2Ftalentpoolltd.ie%2F&#038;format=xml" />
<script type="text/javascript">
(function(url){
	if(/(?:Chrome\/26\.0\.1410\.63 Safari\/537\.31|WordfenceTestMonBot)/.test(navigator.userAgent)){ return; }
	var addEvent = function(evt, handler) {
		if (window.addEventListener) {
			document.addEventListener(evt, handler, false);
		} else if (window.attachEvent) {
			document.attachEvent('on' + evt, handler);
		}
	};
	var removeEvent = function(evt, handler) {
		if (window.removeEventListener) {
			document.removeEventListener(evt, handler, false);
		} else if (window.detachEvent) {
			document.detachEvent('on' + evt, handler);
		}
	};
	var evts = 'contextmenu dblclick drag dragend dragenter dragleave dragover dragstart drop keydown keypress keyup mousedown mousemove mouseout mouseover mouseup mousewheel scroll'.split(' ');
	var logHuman = function() {
		if (window.wfLogHumanRan) { return; }
		window.wfLogHumanRan = true;
		var wfscr = document.createElement('script');
		wfscr.type = 'text/javascript';
		wfscr.async = true;
		wfscr.src = url + '&r=' + Math.random();
		(document.getElementsByTagName('head')[0]||document.getElementsByTagName('body')[0]).appendChild(wfscr);
		for (var i = 0; i < evts.length; i++) {
			removeEvent(evts[i], logHuman);
		}
	};
	for (var i = 0; i < evts.length; i++) {
		addEvent(evts[i], logHuman);
	}
})('//talentpoolltd.ie/?wordfence_lh=1&hid=B50DE032307A319205ABE203BEEB7D37');
</script>
<link rel='dns-prefetch' href='//v0.wordpress.com'/>
<style type='text/css'>img#wpstats{display:none}</style>	<noscript><style>.woocommerce-product-gallery{ opacity: 1 !important; }</style></noscript>
	                <style type="text/css" media="all"
                       id="siteorigin-panels-layouts-head">/* Layout 266 */ #pgc-266-0-0 , #pgc-266-2-0 { width:100%;width:calc(100% - ( 0 * 30px ) ) } #pl-266 #panel-266-0-0-0 , #pl-266 #panel-266-1-0-0 , #pl-266 #panel-266-1-1-0 , #pl-266 #panel-266-1-2-0 , #pl-266 #panel-266-1-3-0 , #pl-266 #panel-266-2-0-0 {  } #pg-266-0 , #pg-266-1 , #pl-266 .so-panel , #pl-266 .so-panel:last-child { margin-bottom:0px } #pgc-266-1-0 , #pgc-266-1-1 , #pgc-266-1-2 , #pgc-266-1-3 { width:25%;width:calc(25% - ( 0.75 * 30px ) ) } #pg-266-0> .panel-row-style { padding:25px } #pg-266-0.panel-no-style, #pg-266-0.panel-has-style > .panel-row-style , #pg-266-1.panel-no-style, #pg-266-1.panel-has-style > .panel-row-style , #pg-266-2.panel-no-style, #pg-266-2.panel-has-style > .panel-row-style { -webkit-align-items:flex-start;align-items:flex-start } #panel-266-0-0-0> .panel-widget-style { background-image:url(https://talentpoolltd.ie/wp-content/uploads/2018/01/cropped-TheTeam.jpg);background-repeat:repeat;color:#000000;padding:-250px 0px 450px 0px } #pg-266-1> .panel-row-style { padding:5% } @media (max-width:780px){ #pg-266-0.panel-no-style, #pg-266-0.panel-has-style > .panel-row-style , #pg-266-1.panel-no-style, #pg-266-1.panel-has-style > .panel-row-style , #pg-266-2.panel-no-style, #pg-266-2.panel-has-style > .panel-row-style { -webkit-flex-direction:column;-ms-flex-direction:column;flex-direction:column } #pg-266-0 > .panel-grid-cell , #pg-266-0 > .panel-row-style > .panel-grid-cell , #pg-266-1 > .panel-grid-cell , #pg-266-1 > .panel-row-style > .panel-grid-cell , #pg-266-2 > .panel-grid-cell , #pg-266-2 > .panel-row-style > .panel-grid-cell { width:100%;margin-right:0 } #pgc-266-1-0 , #pgc-266-1-1 , #pgc-266-1-2 , #pl-266 .panel-grid .panel-grid-cell-mobile-last { margin-bottom:0px } #pl-266 .panel-grid-cell { padding:0 } #pl-266 .panel-grid .panel-grid-cell-empty { display:none }  } </style><link rel="icon" href="https://talentpoolltd.ie/wp-content/uploads/2018/01/cropped-talentpool-favicon-1-32x32.jpg" sizes="32x32" />
<link rel="icon" href="https://talentpoolltd.ie/wp-content/uploads/2018/01/cropped-talentpool-favicon-1-192x192.jpg" sizes="192x192" />
<link rel="apple-touch-icon-precomposed" href="https://talentpoolltd.ie/wp-content/uploads/2018/01/cropped-talentpool-favicon-1-180x180.jpg" />
<meta name="msapplication-TileImage" content="https://talentpoolltd.ie/wp-content/uploads/2018/01/cropped-talentpool-favicon-1-270x270.jpg" />
			<style type="text/css" id="wp-custom-css">
				.site-logo {
    max-height: 150px;
}

.menu .phone-menu {
  display: none;
}

.call-us {
  text-align: right;
  font-size: 20px;
  font-weight: bold;
  padding-right: 10px;
}

.call-us a {
  color: #000000; 
}  

.call-us a:hover {
  color: #a5221d; 
}  

@media only screen and (min-width:768px) and (max-width:1024px) {
  
  .call-us {
    margin-right: -10px;
  }
  
}

@media only screen and (max-width:767px) {
  
  .call-us {
    text-align: center;
  }
  
}
.go-top.show {
	color: black
}

.preloader {
    display: none;
}			</style>
		






<script async src='https://stats.wp.com/s-201921.js'></script>


			

HTML Body Source:

			<body data-rsssl=1 class="home page-template page-template-page-templates page-template-page_front-page page-template-page-templatespage_front-page-php page page-id-266 siteorigin-panels siteorigin-panels-before-js siteorigin-panels-home woocommerce-no-js">

	<div class="preloader">
	    <div class="spinner">
	        <div class="pre-bounce1"></div>
	        <div class="pre-bounce2"></div>
	    </div>
	</div>
	
<div id="page" class="hfeed site">
	<a class="skip-link screen-reader-text" href="#content">Skip to content</a>

		
	<div class="header-clone"></div>

	
	<header id="masthead" class="site-header" role="banner">
		<div class="header-wrap">
            <div class="container">
                <div class="row">
				<div class="col-md-4 col-sm-8 col-xs-12">
		        					<a href="https://talentpoolltd.ie/" title="Talentpool Ltd"><img class="site-logo" src="https://talentpoolltd.ie/wp-content/uploads/2018/01/talentpool_black.png" alt="Talentpool Ltd" /></a>
		        				</div>
				<div class="col-md-8 col-sm-4 col-xs-12">
					<div class="btn-menu"></div>
					<nav id="mainnav" class="mainnav" role="navigation">
						<div class="menu-main-container"><ul id="menu-main" class="menu"><li id="menu-item-296" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-296"><a href="https://talentpoolltd.ie/talentpool/">About Us</a></li>
<li id="menu-item-626" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-626"><a href="https://talentpoolltd.ie/womens-leadership-training/">Women In Leadership</a></li>
<li id="menu-item-298" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-has-children menu-item-298"><a href="https://talentpoolltd.ie/talentpool-programmes/">Programmes</a>
<ul class="sub-menu">
	<li id="menu-item-478" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-478"><a href="https://talentpoolltd.ie/brexit-planning/">Brexit</a></li>
	<li id="menu-item-422" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-422"><a href="https://talentpoolltd.ie/gdpr-data-protection-training/">Data Protection</a></li>
	<li id="menu-item-463" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-463"><a href="https://talentpoolltd.ie/managing-people/">Managing People</a></li>
	<li id="menu-item-446" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-446"><a href="https://talentpoolltd.ie/mediation-qqi-level-6/">Mediation</a></li>
	<li id="menu-item-469" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-469"><a href="https://talentpoolltd.ie/retail-management/">Retail Management</a></li>
	<li id="menu-item-455" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-455"><a href="https://talentpoolltd.ie/training-development-qqi-level-6/">Training and Development</a></li>
</ul>
</li>
<li id="menu-item-512" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-512"><a href="https://talentpoolltd.ie/talentpool-projects/">Our Work</a></li>
<li id="menu-item-384" class="phone-menu menu-item menu-item-type-custom menu-item-object-custom menu-item-384"><a href="tel:0035345864727">Tel: 045 864727</a></li>
<li id="menu-item-577" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-577"><a href="https://talentpoolltd.ie/contact/">Contact</a></li>
</ul></div>					</nav><!-- #site-navigation -->
				</div>
				</div>
			</div>
		</div>
	</header><!-- #masthead -->

	
	<div class="sydney-hero-area">
				<div class="header-image">
			<div class="overlay"></div>			<img class="header-inner" src="https://talentpoolltd.ie/wp-content/themes/sydney/images/header.jpg" width="1920" alt="Talentpool Ltd" title="Talentpool Ltd">
		</div>
		
			</div>

	
	<div id="content" class="page-wrap">
		<div class="container content-wrapper">
			<div class="row">	
	<div id="primary" class="fp-content-area">
		<main id="main" class="site-main" role="main">

			<div class="entry-content">
									<div id="pl-266"  class="panel-layout" ><div id="pg-266-0"  class="panel-grid panel-has-style" ><div class="siteorigin-panels-stretch panel-row-style panel-row-style-for-266-0" style="padding: 25px 0; " data-stretch-type="full-stretched" data-overlay="true" data-overlay-color="#000000" ><div id="pgc-266-0-0"  class="panel-grid-cell" ><div id="panel-266-0-0-0" class="so-panel widget widget_sow-hero panel-first-child panel-last-child" data-index="0" ><div style="text-align: left;" data-title-color="#443f3f" data-headings-color="#ffffff" class="panel-widget-style panel-widget-style-for-266-0-0-0" ><div class="so-widget-sow-hero so-widget-sow-hero-default-abc0ce12061c"><div class="sow-slider-base " style="display: none"><ul class="sow-slider-images" data-settings="{&quot;pagination&quot;:true,&quot;speed&quot;:800,&quot;timeout&quot;:8000,&quot;swipe&quot;:false,&quot;nav_always_show_mobile&quot;:&quot;&quot;,&quot;breakpoint&quot;:&quot;780px&quot;}">		<li class="sow-slider-image  sow-slider-image-cover" style="background-color: #fcfcfc;background-image: url(https://talentpoolltd.ie/wp-content/uploads/2018/01/cropped-TheTeam.jpg)" >
					<div class="sow-slider-image-container">
			<div class="sow-slider-image-wrapper">
				<h1>  </h1>
<h1 style="text-align: center">Training - Mentoring - Coaching</h1>
<h3 style="text-align: center">Helping others see a world of dreams!</h3>
			</div>
		</div>
				</li>
		</ul>				<ol class="sow-slider-pagination">
											<li><a href="#" data-goto="0" aria-label="display slide 1">1</a></li>
									</ol>

				<div class="sow-slide-nav sow-slide-nav-next">
					<a href="#" data-goto="next" aria-label="next slide" data-action="next">
						<em class="sow-sld-icon-thin-right"></em>
					</a>
				</div>

				<div class="sow-slide-nav sow-slide-nav-prev">
					<a href="#" data-goto="previous" aria-label="previous slide" data-action="prev">
						<em class="sow-sld-icon-thin-left"></em>
					</a>
				</div>
				</div></div></div></div></div></div></div><div id="pg-266-1"  class="panel-grid panel-has-style" ><div style="padding: 5% 0; " data-overlay="true" data-overlay-color="#000000" class="panel-row-style panel-row-style-for-266-1" ><div id="pgc-266-1-0"  class="panel-grid-cell" ><div id="panel-266-1-0-0" class="so-panel widget widget_sow-editor panel-first-child panel-last-child" data-index="1" ><div style="text-align: left;" data-title-color="#443f3f" data-headings-color="#443f3f" class="panel-widget-style panel-widget-style-for-266-1-0-0" ><div class="so-widget-sow-editor so-widget-sow-editor-base"><h3 class="widget-title">TRAINING </h3>
<div class="siteorigin-widget-tinymce textwidget">
	<p style="text-align: left;">Talentpool is a QQI registered training provider.   We issue qualifications on the National Framework of Qualifications.</p>
<p>Talentpool directors and trainers have a long history of developing and delivering programmes at QQI levels from level 3 to level 6.  Our consultancy division designs and completes programmes descriptors on a commercial basis.</p>
<p style="text-align: left;">Talentpool works across the country providing business training, mentoring and coaching in all areas of business.  We also deliver a 4 day Women in Leadership programme and have been providing training and coaching services for Women in Leadership roles since 2011.</p>
<p style="text-align: left;">Talentpools facilitators are the most highly qualified and are also entrepreneurs with an enviable track record of enterprise start ups, business management and financial management.</p>
<p style="text-align: left;">Talentpool are currently offering the following QQI certified programmes.</p>
<ul>
<li style="text-align: left;">Training and Development Special Purpose Award</li>
<li style="text-align: left;">Managing People</li>
<li>Mediation Skills</li>
<li>Business Administration</li>
<li>Communications in the Workplace</li>
</ul>
<p style="text-align: center;">
</div>
</div></div></div></div><div id="pgc-266-1-1"  class="panel-grid-cell" ><div id="panel-266-1-1-0" class="so-panel widget widget_sow-editor panel-first-child panel-last-child" data-index="2" ><div style="text-align: left;" data-title-color="#443f3f" data-headings-color="#443f3f" class="panel-widget-style panel-widget-style-for-266-1-1-0" ><div class="so-widget-sow-editor so-widget-sow-editor-base"><h3 class="widget-title">MENTORING</h3>
<div class="siteorigin-widget-tinymce textwidget">
	<p style="text-align: left;">Talentpool mentors listen, advise and provide direction for the needs of businesses. </p>
<p style="text-align: left;">Talentpool mentors assist the business owner or entrepreneur to identify problems and suggest areas for progress or improvement.  We discuss and help with the formulation of solutions and innovative ways of improving the activities of a business.   </p>
<p style="text-align: left;">The mentors will share their experience and knowledge  and assist with the decision making process.  Talentpool can also offer assistance in compiling a business plan for funding applications or pitching. </p>
<p style="text-align: left;">We frequently support mentoring requests for</p>
<ul>
<li style="text-align: left;">Website Planning &amp; Design</li>
<li style="text-align: left;">Business Strategy</li>
<li style="text-align: left;">Financial Planning</li>
<li style="text-align: left;">Distribution</li>
<li style="text-align: left;">Market Research</li>
<li style="text-align: left;">Marketing &amp; Promotion</li>
<li style="text-align: left;">Sales and Selling</li>
<li style="text-align: left;">Recruitment and selection of key employees to allow a business to grow.</li>
</ul>
<p>Talentpool can provide a free first consultation to discuss your business needs.</p>
</div>
</div></div></div></div><div id="pgc-266-1-2"  class="panel-grid-cell" ><div id="panel-266-1-2-0" class="so-panel widget widget_sow-editor panel-first-child panel-last-child" data-index="3" ><div style="text-align: left;" data-title-color="#443f3f" data-headings-color="#443f3f" class="panel-widget-style panel-widget-style-for-266-1-2-0" ><div class="so-widget-sow-editor so-widget-sow-editor-base"><h3 class="widget-title">COACHING</h3>
<div class="siteorigin-widget-tinymce textwidget">
	<p style="text-align: left;">Talentpool has been providing business coaches in Ireland for over ten years. </p>
<p style="text-align: left;">A business coach helps with practical strategies and techniques to create business success and reduce the barriers to progression or success. </p>
<p style="text-align: left;">Coaching can help you increase revenue or profitability, learn new marketing and business skills, reach new customers, make a workable business plan, assist with clarity about the business vision and assist with energy and motivation. </p>
<p style="text-align: left;">Talentpool business coaches can assist with;</p>
<ul>
<li style="text-align: left;">Time management</li>
<li style="text-align: left;">Stress management </li>
<li style="text-align: left;">Prioritisation of tasks to achieve goals and aspirations</li>
<li style="text-align: left;">Succession planning</li>
<li style="text-align: left;">Delegation</li>
<li style="text-align: left;">Communications</li>
</ul>
<p>Talentpool can provide you with a highly qualified and experienced coach with a wealth of experience in business.  If you would like to know more about this please email [email protected] with your contact details and a coach will contact you directly. </p>
<p style="text-align: center;"> </p>
</div>
</div></div></div></div><div id="pgc-266-1-3"  class="panel-grid-cell" ><div id="panel-266-1-3-0" class="so-panel widget widget_sow-editor panel-first-child panel-last-child" data-index="4" ><div style="text-align: left;" data-title-color="#443f3f" data-headings-color="#443f3f" class="panel-widget-style panel-widget-style-for-266-1-3-0" ><div class="so-widget-sow-editor so-widget-sow-editor-base"><h3 class="widget-title">CONSULTANCY</h3>
<div class="siteorigin-widget-tinymce textwidget">
	<p style="text-align: left;"> Talentpool educational specialists  assist with the development of new certified programmes for validation under QQI.   </p>
<p style="text-align: left;">Talentpool educational specialists have worked for organisations such as the Education Training Board, The Citizens Information Service and Exchange House Ireland and Portobello Institute. </p>
<p><img class="alignnone size-medium wp-image-312 aligncenter" src="https://talentpoolltd.ie/wp-content/uploads/2018/01/qq-award-logo-300x173.png" alt="" width="300" height="173" srcset="https://talentpoolltd.ie/wp-content/uploads/2018/01/qq-award-logo-300x173.png 300w, https://talentpoolltd.ie/wp-content/uploads/2018/01/qq-award-logo-230x132.png 230w, https://talentpoolltd.ie/wp-content/uploads/2018/01/qq-award-logo-350x201.png 350w, https://talentpoolltd.ie/wp-content/uploads/2018/01/qq-award-logo.png 417w" sizes="(max-width: 300px) 100vw, 300px" /></p>
<p style="text-align: left;">We also advise on and design new technology programmes for the Enterprise community and have recently rolled out seminars for the new online business planning tools from the Irish Internet Association.   </p>
<p style="text-align: left;">Talentpool have years of experience in the coordination  and management of large scale training and education programmes and can offer full solutions in the implementation and management and delivery of large local or  nationwide programmes.  </p>
<p style="text-align: left;"> </p>
</div>
</div></div></div></div></div></div><div id="pg-266-2"  class="panel-grid panel-has-style" ><div style="padding: 100px 0; " data-overlay="true" data-overlay-color="#000000" class="panel-row-style panel-row-style-for-266-2" ><div id="pgc-266-2-0"  class="panel-grid-cell" ><div id="panel-266-2-0-0" class="so-panel widget widget_wpforms-widget wpforms-widget panel-first-child panel-last-child" data-index="5" ><div style="text-align: left;" data-title-color="#443f3f" data-headings-color="#443f3f" class="panel-widget-style panel-widget-style-for-266-2-0-0" ><h3 class="widget-title">Subscribe here to get updates</h3><div class="wpforms-container wpforms-container-full" id="wpforms-566"><form id="wpforms-form-566" class="wpforms-validate wpforms-form" data-formid="566" method="post" enctype="multipart/form-data" action="/"><div class="wpforms-field-container"><div id="wpforms-566-field_0-container" class="wpforms-field wpforms-field-name" data-field-id="0"><label class="wpforms-field-label" for="wpforms-566-field_0">Name <span class="wpforms-required-label">*</span></label><div class="wpforms-field-row wpforms-field-medium"><div class="wpforms-field-row-block wpforms-first wpforms-one-half"><input type="text" id="wpforms-566-field_0" class="wpforms-field-name-first wpforms-field-required" name="wpforms[fields][0][first]" required><label for="wpforms-566-field_0" class="wpforms-field-sublabel after ">First</label></div><div class="wpforms-field-row-block wpforms-one-half"><input type="text" id="wpforms-566-field_0-last" class="wpforms-field-name-last wpforms-field-required" name="wpforms[fields][0][last]" required><label for="wpforms-566-field_0-last" class="wpforms-field-sublabel after ">Last</label></div></div></div><div id="wpforms-566-field_1-container" class="wpforms-field wpforms-field-email" data-field-id="1"><label class="wpforms-field-label" for="wpforms-566-field_1">Email <span class="wpforms-required-label">*</span></label><input type="email" id="wpforms-566-field_1" class="wpforms-field-medium wpforms-field-required" name="wpforms[fields][1]" required></div><div id="wpforms-566-field_4-container" class="wpforms-field wpforms-field-select" data-field-id="4"><label class="wpforms-field-label" for="wpforms-566-field_4">Area <span class="wpforms-required-label">*</span></label><select name="wpforms[fields][4]" id="wpforms-566-field_4" class="wpforms-field-medium wpforms-field-required"  required><option value="Antrim" >Antrim</option><option value="Armagh" >Armagh</option><option value="Carlow" >Carlow</option><option value="Cavan" >Cavan</option><option value="Clare" >Clare</option><option value="Cork" >Cork</option><option value="Derry" >Derry</option><option value="Donegal" >Donegal</option><option value="Down" >Down</option><option value="Dublin" >Dublin</option><option value="Fermanagh" >Fermanagh</option><option value="Galway" >Galway</option><option value="Kerry" >Kerry</option><option value="Kildare" >Kildare</option><option value="Kilkenny" >Kilkenny</option><option value="Laois" >Laois</option><option value="Leitrim" >Leitrim</option><option value="Limerick" >Limerick</option><option value="Longford" >Longford</option><option value="Louth" >Louth</option><option value="Mayo" >Mayo</option><option value="Meath" >Meath</option><option value="Monaghan" >Monaghan</option><option value="Offaly" >Offaly</option><option value="Roscommon" >Roscommon</option><option value="Sligo" >Sligo</option><option value="Tipperary" >Tipperary</option><option value="Tyrone" >Tyrone</option><option value="Waterford" >Waterford</option><option value="Westmeath" >Westmeath</option><option value="Wexford" >Wexford</option><option value="Wicklow" >Wicklow</option></select></div></div><div class="wpforms-field wpforms-field-hp"><label for="wpforms-566-field-hp" class="wpforms-field-label">Comment</label><input type="text" name="wpforms[hp]" id="wpforms-566-field-hp" class="wpforms-field-medium"></div><div class="wpforms-submit-container" ><input type="hidden" name="wpforms[id]" value="566"><input type="hidden" name="wpforms[author]" value="2"><input type="hidden" name="wpforms[post_id]" value="266"><button type="submit" name="wpforms[submit]" class="wpforms-submit " id="wpforms-submit-566" value="wpforms-submit" data-alt-text="Sending...">Submit</button></div></form></div></div></div></div></div></div></div>							</div><!-- .entry-content -->

		</main><!-- #main -->
	</div><!-- #primary -->

			</div>
		</div>
	</div><!-- #content -->

	
			

	
	<div id="sidebar-footer" class="footer-widgets widget-area" role="complementary">
		<div class="container">
							<div class="sidebar-column col-md-3">
					<aside id="sow-editor-2" class="widget widget_sow-editor"><div class="so-widget-sow-editor so-widget-sow-editor-base">
<div class="siteorigin-widget-tinymce textwidget">
	<p>Mobile: <a href="tel:087 9485035">+353 087 9485035</a><a href="tel:+353879485035"> </a></p>
<p>Tel: <a href="tel:+353 45 864727">+353 45 864727</a></p>
<p><a href="mailto:[email protected]">[email protected]</a></p>
<p><a href="https://talentpoolltd.ie/privacy/">Privacy Policy</a></p>
</div>
</div></aside>				</div>
				
							<div class="sidebar-column col-md-3">
					<aside id="sow-editor-3" class="widget widget_sow-editor"><div class="so-widget-sow-editor so-widget-sow-editor-base">
<div class="siteorigin-widget-tinymce textwidget">
	</div>
</div></aside>				</div>
				
							<div class="sidebar-column col-md-3">
					<aside id="sow-editor-4" class="widget widget_sow-editor"><div class="so-widget-sow-editor so-widget-sow-editor-base">
<div class="siteorigin-widget-tinymce textwidget">
	</div>
</div></aside>				</div>
				
							<div class="sidebar-column col-md-3">
					<aside id="sow-social-media-buttons-2" class="widget widget_sow-social-media-buttons"><div class="so-widget-sow-social-media-buttons so-widget-sow-social-media-buttons-atom-9561db3302fa">
<div class="social-media-button-container">
	
		<a class="ow-button-hover sow-social-media-button-twitter sow-social-media-button" title="Talentpool Ltd on Twitter" aria-label="Talentpool Ltd on Twitter" target="_blank" rel="noopener noreferrer" href="https://twitter.com/" >
			<span>
								<span class="sow-icon-fontawesome sow-fab" data-sow-icon="&#xf099;" ></span>							</span>
		</a>
	
		<a class="ow-button-hover sow-social-media-button-linkedin sow-social-media-button" title="Talentpool Ltd on Linkedin" aria-label="Talentpool Ltd on Linkedin" target="_blank" rel="noopener noreferrer" href="https://www.linkedin.com/company/talentpool-ltd/" >
			<span>
								<span class="sow-icon-fontawesome sow-fab" data-sow-icon="&#xf0e1;" ></span>							</span>
		</a>
	
		<a class="ow-button-hover sow-social-media-button-pinterest sow-social-media-button" title="Talentpool Ltd on Pinterest" aria-label="Talentpool Ltd on Pinterest" target="_blank" rel="noopener noreferrer" href="https://www.pinterest.com/" >
			<span>
								<span class="sow-icon-fontawesome sow-fab" data-sow-icon="&#xf0d2;" ></span>							</span>
		</a>
	
		<a class="ow-button-hover sow-social-media-button-facebook sow-social-media-button" title="Talentpool Ltd on Facebook" aria-label="Talentpool Ltd on Facebook" target="_blank" rel="noopener noreferrer" href="https://www.facebook.com/talentpoolltd/" >
			<span>
								<span class="sow-icon-fontawesome sow-fab" data-sow-icon="&#xf39e;" ></span>							</span>
		</a>
	</div>
</div></aside>				</div>
				
		</div>	
	</div>	
    <a class="go-top"><i class="fa fa-angle-up"></i></a>
		
	<footer id="colophon" class="site-footer" role="contentinfo">
		<div class="site-info container">
			<a href="mailto:[email protected]">Contact us by email at [email protected]</a>
			<span class="sep"> | </span>
			Copyright©: <a href="https://talentpoolltd.ie" rel="designer">2018 All Rights reserved</a>  .		</div><!-- .site-info -->
	</footer><!-- #colophon -->

	
</div><!-- #page -->









	<div style="display:none">
	</div>
	<script type="text/javascript">
		var c = document.body.className;
		c = c.replace(/woocommerce-no-js/, 'woocommerce-js');
		document.body.className = c;
	</script>
	<link rel='stylesheet' id='sow-hero-default-abc0ce12061c-css'  href='https://talentpoolltd.ie/wp-content/uploads/siteorigin-widgets/sow-hero-default-abc0ce12061c.css?ver=4.9.10' type='text/css' media='all' />
<link rel='stylesheet' id='sow-slider-slider-css'  href='https://talentpoolltd.ie/wp-content/plugins/so-widgets-bundle/css/slider/slider.css?ver=1.15.4' type='text/css' media='all' />
<link rel='stylesheet' id='sow-social-media-buttons-atom-9561db3302fa-css'  href='https://talentpoolltd.ie/wp-content/uploads/siteorigin-widgets/sow-social-media-buttons-atom-9561db3302fa.css?ver=4.9.10' type='text/css' media='all' />
<link rel='stylesheet' id='siteorigin-widget-icon-font-fontawesome-css'  href='https://talentpoolltd.ie/wp-content/plugins/so-widgets-bundle/icons/fontawesome/style.css?ver=4.9.10' type='text/css' media='all' />
<link rel='stylesheet' id='wpforms-smart-phone-field-css'  href='https://talentpoolltd.ie/wp-content/plugins/wpforms/pro/assets/css/vendor/intl-tel-input.min.css?ver=15.0.0' type='text/css' media='all' />
<link rel='stylesheet' id='wpforms-full-css'  href='https://talentpoolltd.ie/wp-content/plugins/wpforms/assets/css/wpforms-full.css?ver=1.5.2.2' type='text/css' media='all' />
<script type='text/javascript' src='https://s0.wp.com/wp-content/js/devicepx-jetpack.js?ver=201921'></script>
<script type='text/javascript' src='https://talentpoolltd.ie/wp-content/plugins/woocommerce/assets/js/jquery-blockui/jquery.blockUI.min.js?ver=2.70'></script>
<script type='text/javascript'>
/* <![CDATA[ */
var wc_add_to_cart_params = {"ajax_url":"\/wp-admin\/admin-ajax.php","wc_ajax_url":"\/?wc-ajax=%%endpoint%%","i18n_view_cart":"View basket","cart_url":"https:\/\/talentpoolltd.ie\/cart\/","is_cart":"","cart_redirect_after_add":"yes"};
/* ]]> */
</script>
<script type='text/javascript' src='https://talentpoolltd.ie/wp-content/plugins/woocommerce/assets/js/frontend/add-to-cart.min.js?ver=3.6.1'></script>
<script type='text/javascript' src='https://talentpoolltd.ie/wp-content/plugins/woocommerce/assets/js/js-cookie/js.cookie.min.js?ver=2.1.4'></script>
<script type='text/javascript'>
/* <![CDATA[ */
var woocommerce_params = {"ajax_url":"\/wp-admin\/admin-ajax.php","wc_ajax_url":"\/?wc-ajax=%%endpoint%%"};
/* ]]> */
</script>
<script type='text/javascript' src='https://talentpoolltd.ie/wp-content/plugins/woocommerce/assets/js/frontend/woocommerce.min.js?ver=3.6.1'></script>
<script type='text/javascript'>
/* <![CDATA[ */
var wc_cart_fragments_params = {"ajax_url":"\/wp-admin\/admin-ajax.php","wc_ajax_url":"\/?wc-ajax=%%endpoint%%","cart_hash_key":"wc_cart_hash_01365f5b991204af7de2713e07e579a3","fragment_name":"wc_fragments_01365f5b991204af7de2713e07e579a3","request_timeout":"5000"};
/* ]]> */
</script>
<script type='text/javascript' src='https://talentpoolltd.ie/wp-content/plugins/woocommerce/assets/js/frontend/cart-fragments.min.js?ver=3.6.1'></script>
<script type='text/javascript'>
		jQuery( 'body' ).bind( 'wc_fragments_refreshed', function() {
			jQuery( 'body' ).trigger( 'jetpack-lazy-images-load' );
		} );
	
</script>
<script type='text/javascript' src='https://secure.gravatar.com/js/gprofiles.js?ver=2019Mayaa'></script>
<script type='text/javascript'>
/* <![CDATA[ */
var WPGroHo = {"my_hash":""};
/* ]]> */
</script>
<script type='text/javascript' src='https://talentpoolltd.ie/wp-content/plugins/jetpack/modules/wpgroho.js?ver=4.9.10'></script>
<script type='text/javascript' src='https://talentpoolltd.ie/wp-content/themes/sydney/js/scripts.js?ver=4.9.10'></script>
<script type='text/javascript' src='https://talentpoolltd.ie/wp-content/themes/sydney/js/main.min.js?ver=20180716'></script>
<script type='text/javascript' src='https://talentpoolltd.ie/wp-content/themes/sydney/js/skip-link-focus-fix.js?ver=20130115'></script>
<script type='text/javascript' src='https://talentpoolltd.ie/wp-content/plugins/jetpack/_inc/build/widgets/eu-cookie-law/eu-cookie-law.min.js?ver=20180522'></script>
<script type='text/javascript' src='https://talentpoolltd.ie/wp-includes/js/wp-embed.min.js?ver=4.9.10'></script>
<script type='text/javascript'>
/* <![CDATA[ */
var panelsStyles = {"fullContainer":"body"};
/* ]]> */
</script>
<script type='text/javascript' src='https://talentpoolltd.ie/wp-content/plugins/siteorigin-panels/js/styling-2105.min.js?ver=2.10.5'></script>
<script type='text/javascript' src='https://talentpoolltd.ie/wp-content/plugins/so-widgets-bundle/js/jquery.cycle.min.js?ver=1.15.4'></script>
<script type='text/javascript' src='https://talentpoolltd.ie/wp-content/plugins/so-widgets-bundle/js/slider/jquery.slider.min.js?ver=1.15.4'></script>
<script type='text/javascript' src='https://talentpoolltd.ie/wp-content/plugins/wpforms/pro/assets/js/vendor/jquery.intl-tel-input.min.js?ver=15.0.0'></script>
<script type='text/javascript' src='https://talentpoolltd.ie/wp-content/plugins/wpforms/assets/js/jquery.validate.min.js?ver=1.19.0'></script>
<script type='text/javascript' src='https://talentpoolltd.ie/wp-content/plugins/wpforms/assets/js/mailcheck.min.js?ver=1.1.2'></script>
<script type='text/javascript' src='https://talentpoolltd.ie/wp-content/plugins/wpforms/assets/js/wpforms.js?ver=1.5.2.2'></script>
<script type="text/javascript">
;(function($) {

   'use strict'

   if( $('.phone-menu').length ) { 
   
    var phone = $('.phone-menu').html();

    $('.site-header .col-md-8').prepend('<div class="call-us">'+phone+'</div>');

  }

})(jQuery);
</script><script type='text/javascript'>
/* <![CDATA[ */
var wpforms_settings = {"val_required":"This field is required.","val_url":"Please enter a valid URL.","val_email":"Please enter a valid email address.","val_email_suggestion":"Did you mean {suggestion}?","val_email_suggestion_title":"Click to accept this suggestion.","val_number":"Please enter a valid number.","val_confirm":"Field values do not match.","val_fileextension":"File type is not allowed.","val_filesize":"File exceeds max size allowed.","val_time12h":"Please enter time in 12-hour AM\/PM format (eg 8:45 AM).","val_time24h":"Please enter time in 24-hour format (eg 22:45).","val_requiredpayment":"Payment is required.","val_creditcard":"Please enter a valid credit card number.","val_smart_phone":"Please enter a valid phone number.","val_post_max_size":"The total size of the selected files {totalSize} Mb exceeds the allowed limit {maxSize} Mb.","val_checklimit":"You have exceeded the number of allowed selections: {#}.","post_max_size":"33554432","uuid_cookie":"1","locale":"en","wpforms_plugin_url":"https:\/\/talentpoolltd.ie\/wp-content\/plugins\/wpforms\/","gdpr":"","currency_code":"USD","currency_thousands":",","currency_decimal":".","currency_symbol":"$","currency_symbol_pos":"left"}
/* ]]> */
</script>
<script type="text/javascript">document.body.className = document.body.className.replace("siteorigin-panels-before-js","");</script><script type='text/javascript' src='https://stats.wp.com/e-201921.js' async='async' defer='defer'></script>
<script type='text/javascript'>
	_stq = window._stq || [];
	_stq.push([ 'view', {v:'ext',j:'1:7.1.1',blog:'141680525',post:'266',tz:'1',srv:'talentpoolltd.ie'} ]);
	_stq.push([ 'clickTrackerInit', '141680525', '266' ]);
</script>









</body>


			

Validate HTML & CSS

Validate HTML & CSS:

Validate HTML
Validate CSS

Document Information

  • Doctype: html
  • Doctype PublicId: -//W3C//DTD HTML 4.0 Transitional//EN
  • Doctype SystemId: http://www.w3.org/TR/REC-html40/loose.dtd
  • Encoding: UTF-8

Word Count

Found 578 total words, using 286 different words.

  • 35and
  • 21the
  • 19business
  • 16of
  • 14a
  • 14talentpool
  • 11with
  • 11to
  • 10for
  • 10in
  • 9training
  • 8programmes
  • 7management
  • 6or
  • 6can
  • 6assist
  • 5coaching
  • 5have
  • 5new
  • 5we
  • 4mentoring
  • 4also
  • 4you
  • 4contact
  • 4qqi
  • 4planning
  • 3mentors
  • 3providing
  • 3ie
  • 3coach
  • 3are
  • 3provide
  • 3info
  • 3talentpoolltd
  • 3women
  • 3experience
  • 3about
  • 3leadership
  • 3on
  • 3development
  • 2financial
  • 2educational
  • 2specialists
  • 2qualified
  • 2areas
  • 2all
  • 2been
  • 2your
  • 2years
  • 2highly
  • 2enterprise
  • 2communications
  • 2solutions
  • 2help
  • 2success
  • 2will
  • 2design
  • 2plan
  • 2offer
  • 2discuss
  • 2marketing
  • 2skills
  • 2email
  • 2coaches
  • 2advise
  • 2ireland
  • 2needs
  • 2certified
  • 2education
  • 2mediation
  • 2people
  • 2consultancy
  • 2864727
  • 2level
  • 2from
  • 2tel
  • 2at
  • 2large
  • 2our
  • 2managing
  • 2qualifications
  • 2353
  • 2us
  • 1workable
  • 1clarity
  • 1087
  • 1privacy
  • 1make
  • 1aspirations
  • 1vision
  • 1succession
  • 1goals
  • 1customers
  • 1motivation
  • 1stress
  • 1time
  • 1prioritisation
  • 1tasks
  • 1energy
  • 19485035
  • 1achieve
  • 145
  • 1learn
  • 1helps
  • 1practical
  • 1strategies
  • 1techniques
  • 12018
  • 1rights
  • 1has
  • 1reserved
  • 1over
  • 1ten
  • 1create
  • 1copyright
  • 1revenue
  • 1profitability
  • 1delegation
  • 1reach
  • 1increase
  • 1by
  • 1reduce
  • 1barriers
  • 1progression
  • 1policy
  • 1mobile
  • 1board
  • 1association
  • 1citizens
  • 1information
  • 1service
  • 1as
  • 1coordination
  • 1under
  • 1worked
  • 1organisations
  • 1such
  • 1internet
  • 1exchange
  • 1seminars
  • 1online
  • 1out
  • 1rolled
  • 1community
  • 1tools
  • 1technology
  • 1irish
  • 1house
  • 1portobello
  • 1institute
  • 1validation
  • 1scale
  • 1know
  • 1area
  • 1firstlastemail
  • 1updatesname
  • 1more
  • 1like
  • 1antrimarmaghcarlowcavanclarecorkderrydonegaldowndublinfermanaghgalwaykerrykildarekilkennylaoisleitrimlimericklongfordlouthmayomeathmonaghanoffalyroscommonsligotipperarytyronewaterfordwestmeathwexfordwicklowcommentsubmit
  • 1wealth
  • 1if
  • 1recently
  • 1would
  • 1get
  • 1this
  • 1implementation
  • 1details
  • 1directly
  • 1full
  • 1delivery
  • 1local
  • 1please
  • 1here
  • 1subscribe
  • 1nationwide
  • 1experienced
  • 1decision
  • 1across
  • 1works
  • 1country
  • 1deliver
  • 14
  • 1basis
  • 1commercial
  • 1division
  • 16
  • 1designs
  • 1completes
  • 1descriptors
  • 1day
  • 1programme
  • 1an
  • 1entrepreneurs
  • 1enviable
  • 1track
  • 1record
  • 1most
  • 1facilitators
  • 1roles
  • 1services
  • 1since
  • 12011
  • 1talentpools
  • 13
  • 1levels
  • 1others
  • 1helping
  • 1see
  • 1world
  • 1dreams
  • 1045
  • 1work
  • 1brexit
  • 1content
  • 1data
  • 1protection
  • 1retail
  • 11
  • 1is
  • 1long
  • 1trainers
  • 1history
  • 1developing
  • 1delivering
  • 1directors
  • 1framework
  • 1registered
  • 1provider
  • 1issue
  • 1national
  • 1start
  • 1ups
  • 1support
  • 1frequently
  • 1requests
  • 1website
  • 1strategy
  • 1pitching
  • 1applications
  • 1process
  • 1making
  • 1assistance
  • 1compiling
  • 1funding
  • 1distribution
  • 1market
  • 1allow
  • 1employees
  • 1grow
  • 1free
  • 1first
  • 1key
  • 1selection
  • 1promotion
  • 1research
  • 1sales
  • 1selling
  • 1recruitment
  • 1skip
  • 1knowledge
  • 1listen
  • 1workplace
  • 1direction
  • 1businesses
  • 1owner
  • 1administration
  • 1award
  • 1offering
  • 1currently
  • 1following
  • 1special
  • 1purpose
  • 1entrepreneur
  • 1identify
  • 1improving
  • 1ways
  • 1activities
  • 1share
  • 1their
  • 1innovative
  • 1formulation
  • 1problems
  • 1suggest
  • 1progress
  • 1improvement
  • 1consultation

Keywords

Word Density

  • Word Density: 273
  • 35 and
  • 21 the
  • 19 business
  • 16 talentpool
  • 11 with
  • 10 for
  • 09 training
  • 08 programmes
  • 07 management
  • 06 can
  • 06 assist
  • 05 new
  • 05 have
  • 05 coaching
  • 04 qqi
  • 04 contact
  • 04 you
  • 04 also
  • 04 mentoring
  • 04 planning
  • 03 email
  • 03 leadership
  • 03 coach
  • 03 development
  • 03 info
  • 03 are
  • 03 talentpoolltd
  • 03 providing
  • 03 provide
  • 03 about
  • 03 experience
  • 03 women
  • 03 mentors
  • 02 864727
  • 02 years
  • 02 people
  • 02 353
  • 02 our
  • 02 success
  • 02 qualifications
  • 02 advise
  • 02 large
  • 02 needs
  • 02 consultancy
  • 02 communications
  • 02 managing
  • 02 ltd
  • 02 design
  • 02 marketing
  • 02 from
  • 02 level
  • 02 first
  • 02 discuss
  • 02 tel
  • 02 areas
  • 02 been
  • 02 qualified
  • 02 will
  • 02 certified
  • 02 specialists
  • 02 plan
  • 02 mediation
  • 02 help
  • 02 educational
  • 02 coaches
  • 02 all
  • 02 financial
  • 02 solutions
  • 02 ireland
  • 02 enterprise
  • 02 offer
  • 02 your
  • 02 highly
  • 02 skills
  • 02 education
  • 01 trainers
  • 01 delivering
  • 01 levels
  • 01 developing
  • 01 dreams
  • 01 data
  • 01 directors
  • 01 protection
  • 01 registered
  • 01 history
  • 01 long
  • 01 website
  • 01 support
  • 01 brexit
  • 01 strategy
  • 01 distribution
  • 01 requests
  • 01 following
  • 01 issue
  • 01 national
  • 01 framework
  • 01 offering
  • 01 provider
  • 01 most
  • 01 ups
  • 01 start
  • 01 currently
  • 01 enviable
  • 01 entrepreneurs
  • 01 track
  • 01 record
  • 01 frequently
  • 01 basis
  • 01 roles
  • 01 since
  • 01 2011
  • 01 talentpools
  • 01 see
  • 01 world
  • 01 work
  • 01 retail
  • 01 others
  • 01 045
  • 01 facilitators
  • 01 designs
  • 01 division
  • 01 helping
  • 01 content
  • 01 decision
  • 01 share
  • 01 suggest
  • 01 activities
  • 01 their
  • 01 knowledge
  • 01 problems
  • 01 administration
  • 01 workplace
  • 01 special
  • 01 purpose
  • 01 award
  • 01 commercial
  • 01 improving
  • 01 twitter
  • 01 linkedin
  • 01 pinterest
  • 01 facebook
  • 01 has
  • 01 innovative
  • 01 ways
  • 01 progress
  • 01 improvement
  • 01 formulation
  • 01 listen
  • 01 identify
  • 01 employees
  • 01 allow
  • 01 grow
  • 01 free
  • 01 consultation
  • 01 research
  • 01 market
  • 01 assistance
  • 01 skip
  • 01 funding
  • 01 applications
  • 01 key
  • 01 selection
  • 01 businesses
  • 01 direction
  • 01 owner
  • 01 entrepreneur
  • 01 making
  • 01 process
  • 01 promotion
  • 01 sales
  • 01 selling
  • 01 recruitment
  • 01 pitching
  • 01 internet
  • 01 make
  • 01 like
  • 01 workable
  • 01 tasks
  • 01 citizens
  • 01 reach
  • 01 clarity
  • 01 time
  • 01 stress
  • 01 prioritisation
  • 01 vision
  • 01 subscribe
  • 01 nationwide
  • 01 association
  • 01 scale
  • 01 full
  • 01 implementation
  • 01 coordination
  • 01 delivery
  • 01 here
  • 01 get
  • 01 updates
  • 01 local
  • 01 energy
  • 01 motivation
  • 01 goals
  • 01 wealth
  • 01 customers
  • 01 barriers
  • 01 reduce
  • 01 would
  • 01 aspirations
  • 01 succession
  • 01 achieve
  • 01 delegation
  • 01 experienced
  • 01 progression
  • 01 increase
  • 01 practical
  • 01 strategies
  • 01 profitability
  • 01 learn
  • 01 helps
  • 01 over
  • 01 revenue
  • 01 create
  • 01 techniques
  • 01 ten
  • 01 name
  • 01 last
  • 01 recently
  • 01 tools
  • 01 community
  • 01 house
  • 01 portobello
  • 01 online
  • 01 seminars
  • 01 service
  • 01 exchange
  • 01 out
  • 01 rolled
  • 01 institute
  • 01 technology
  • 01 services
  • 01 across
  • 01 works
  • 01 completes
  • 01 programme
  • 01 day
  • 01 know
  • 01 compiling
  • 01 deliver
  • 01 country
  • 01 directly
  • 01 details
  • 01 comment
  • 01 9485035
  • 01 area
  • 01 submit
  • 01 mobile
  • 01 privacy
  • 01 reserved
  • 01 copyright
  • 01 policy
  • 01 2018
  • 01 rights
  • 01 087
  • 01 irish
  • 01 validation
  • 01 this
  • 01 more
  • 01 please
  • 01 under
  • 01 information
  • 01 organisations
  • 01 worked
  • 01 such
  • 01 board
  • 01 descriptors

Word Weights

  • Word Weights: 273
  • 35 and
  • 21 the
  • 21 talentpool
  • 19 business
  • 11 with
  • 10 for
  • 09 training
  • 08 programmes
  • 07 ltd
  • 07 management
  • 06 can
  • 06 assist
  • 05 new
  • 05 have
  • 05 coaching
  • 04 qqi
  • 04 contact
  • 04 you
  • 04 planning
  • 04 also
  • 04 mentoring
  • 03 email
  • 03 leadership
  • 03 coach
  • 03 development
  • 03 info
  • 03 are
  • 03 talentpoolltd
  • 03 experience
  • 03 provide
  • 03 about
  • 03 providing
  • 03 women
  • 03 mentors
  • 02 864727
  • 02 years
  • 02 our
  • 02 353
  • 02 success
  • 02 people
  • 02 advise
  • 02 large
  • 02 needs
  • 02 level
  • 02 design
  • 02 communications
  • 02 managing
  • 02 marketing
  • 02 consultancy
  • 02 discuss
  • 02 from
  • 02 first
  • 02 qualifications
  • 02 tel
  • 02 areas
  • 02 been
  • 02 qualified
  • 02 will
  • 02 certified
  • 02 specialists
  • 02 plan
  • 02 mediation
  • 02 help
  • 02 educational
  • 02 coaches
  • 02 all
  • 02 financial
  • 02 solutions
  • 02 ireland
  • 02 enterprise
  • 02 offer
  • 02 your
  • 02 highly
  • 02 skills
  • 02 education
  • 01 trainers
  • 01 delivering
  • 01 levels
  • 01 developing
  • 01 dreams
  • 01 data
  • 01 directors
  • 01 protection
  • 01 registered
  • 01 history
  • 01 long
  • 01 website
  • 01 support
  • 01 brexit
  • 01 strategy
  • 01 distribution
  • 01 requests
  • 01 following
  • 01 issue
  • 01 national
  • 01 framework
  • 01 offering
  • 01 provider
  • 01 most
  • 01 ups
  • 01 start
  • 01 currently
  • 01 enviable
  • 01 entrepreneurs
  • 01 track
  • 01 record
  • 01 frequently
  • 01 basis
  • 01 roles
  • 01 since
  • 01 2011
  • 01 talentpools
  • 01 see
  • 01 world
  • 01 work
  • 01 retail
  • 01 others
  • 01 045
  • 01 facilitators
  • 01 designs
  • 01 division
  • 01 helping
  • 01 content
  • 01 decision
  • 01 share
  • 01 suggest
  • 01 activities
  • 01 their
  • 01 knowledge
  • 01 problems
  • 01 administration
  • 01 workplace
  • 01 special
  • 01 purpose
  • 01 award
  • 01 commercial
  • 01 improving
  • 01 twitter
  • 01 linkedin
  • 01 pinterest
  • 01 facebook
  • 01 has
  • 01 innovative
  • 01 ways
  • 01 progress
  • 01 improvement
  • 01 formulation
  • 01 listen
  • 01 identify
  • 01 employees
  • 01 allow
  • 01 grow
  • 01 free
  • 01 consultation
  • 01 research
  • 01 market
  • 01 assistance
  • 01 skip
  • 01 funding
  • 01 applications
  • 01 key
  • 01 selection
  • 01 businesses
  • 01 direction
  • 01 owner
  • 01 entrepreneur
  • 01 making
  • 01 process
  • 01 promotion
  • 01 sales
  • 01 selling
  • 01 recruitment
  • 01 pitching
  • 01 internet
  • 01 make
  • 01 like
  • 01 workable
  • 01 tasks
  • 01 citizens
  • 01 reach
  • 01 clarity
  • 01 time
  • 01 stress
  • 01 prioritisation
  • 01 vision
  • 01 subscribe
  • 01 nationwide
  • 01 association
  • 01 scale
  • 01 full
  • 01 implementation
  • 01 coordination
  • 01 delivery
  • 01 here
  • 01 get
  • 01 updates
  • 01 local
  • 01 energy
  • 01 motivation
  • 01 goals
  • 01 wealth
  • 01 customers
  • 01 barriers
  • 01 reduce
  • 01 would
  • 01 aspirations
  • 01 succession
  • 01 achieve
  • 01 delegation
  • 01 experienced
  • 01 progression
  • 01 increase
  • 01 practical
  • 01 strategies
  • 01 profitability
  • 01 learn
  • 01 helps
  • 01 over
  • 01 revenue
  • 01 create
  • 01 techniques
  • 01 ten
  • 01 name
  • 01 last
  • 01 recently
  • 01 tools
  • 01 community
  • 01 house
  • 01 portobello
  • 01 online
  • 01 seminars
  • 01 service
  • 01 exchange
  • 01 out
  • 01 rolled
  • 01 institute
  • 01 technology
  • 01 services
  • 01 across
  • 01 works
  • 01 completes
  • 01 programme
  • 01 day
  • 01 know
  • 01 compiling
  • 01 deliver
  • 01 country
  • 01 directly
  • 01 details
  • 01 comment
  • 01 9485035
  • 01 area
  • 01 submit
  • 01 mobile
  • 01 privacy
  • 01 reserved
  • 01 copyright
  • 01 policy
  • 01 2018
  • 01 rights
  • 01 087
  • 01 irish
  • 01 validation
  • 01 this
  • 01 more
  • 01 please
  • 01 under
  • 01 information
  • 01 organisations
  • 01 worked
  • 01 such
  • 01 board
  • 01 descriptors